Details for Capsella Locus Carubv10015265m

Position : scaf_3 ( 5`- 8094686 .. 8095263 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015265m

Protein [Map View]
MDQSENNSFSVEKPLHTSSGPYTSPPPIGYPTREPMVGDPPAGPVETTSRGVPNAEALDSAVQKGSLSTLWGCCCGDDAA
T*

DNA
ATGGATCAATCCGAAAACAATTCCTTTTCCGTGGAAAAACCTTTACATACTTCATCAGGTCCCTACACGAGTCCGCCGCC
GATTGGTTACCCGACTAGAGAACCGATGGTTGGTGACCCTCCGGCAGGACCAGTGGAAACAACTTCCAGGGGCGTTCCGA
ACGCAGAAGCCCTAGACAGCGCAGTGCAAAAAGGAAGTTTGTCTACGCTTTGGGGTTGCTGCTGCGGAGACGACGCGGCA
ACATGA