Details for Capsella Locus Carubv10015264m

Position : scaf_3 ( 5`- 3807386 .. 3810282 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015264m

Protein [Map View]
MTTTLNRPGPSKVKDVYSRETERTYLIGKSISTFFARLVGYASAAGCSLLTSSPRFFLYPQIFRFLNQISCVSLRIQLSM
QTKREVSEYRERLNETLSSPELSDDQTLKTLIRKQLYEECNVDILDQRVAALSSAIEKLRSVSAKDQDLSKSSNEASYGD
WKLKHDDEHCRVMYREGLKGSPFHTLLVEGCVDGTIEDCLCVCWESSFYEKWWPKMVFPSFRVLEAKCLQKCRIDEQICL
LRVKAPWPLTDREAILQFFVFEYFKDGLVIILLNSIEVESNGIAEVANAVRIDFVGGVAIQKGTPERSYVRFIAEVDIKL
DLVPPSLINFMSRQLLGNGFTLFKKTIGSVAYSDDYTRVLADPLYTQIHEALYSTAKTNEICQVNDVFSEQGRGCEEKEL
KLEANDLYMAKENETRHRENESVSCKRYVPEIEEEDCVNGKEEYKSVPSSSSSSSVEDENITRKTQNKNGKTRFCISPEV
KQALGTLERVISMVRKTKTDNNKASTSSEEEEEEETSSSPLQNSGSIHLVSNSKVCIQDPKTELLDEASFAHYNNNNNNS
NRRSGSSSFAREGNKVAPASPEIDLTTNSEVPRITVSQATTLFSQTTENSDDKPSGLNGGSSSLQRKSNPGCFGFRFCIR
T*

DNA
ATGACAACGACACTTAACCGACCTGGTCCCTCTAAAGTAAAAGATGTATATTCCCGAGAAACTGAGAGAACGTATCTAAT
CGGGAAGAGTATCTCCACGTTCTTTGCCCGTCTCGTAGGTTACGCATCAGCAGCTGGGTGTTCCCTTCTCACTTCCTCAC
CACGATTCTTCTTGTATCCACAAATTTTTAGGTTCTTAAATCAAATCTCCTGTGTGTCTCTACGGATTCAATTGAGTATG
CAGACGAAACGAGAAGTTTCTGAGTACAGAGAGAGACTTAATGAGACCTTGTCGTCTCCTGAGCTCTCTGATGACCAAAC
TCTCAAGACCCTAATCAGAAAACAGCTCTATGAAGAGTGTAATGTGGATATACTGGATCAGAGAGTAGCTGCTTTATCCA
GTGCAATTGAGAAGCTTAGGAGTGTATCAGCAAAGGATCAAGACTTGTCTAAGTCAAGCAACGAGGCGTCTTATGGTGAT
TGGAAATTGAAACATGATGATGAACATTGTCGTGTTATGTACCGTGAAGGACTTAAAGGAAGTCCATTTCATACACTGCT
CGTTGAAGGTTGCGTTGATGGGACTATCGAAGACTGTTTATGTGTATGCTGGGAATCTTCATTCTATGAGAAATGGTGGC
CAAAAATGGTTTTTCCGTCATTCAGGGTCTTAGAAGCTAAATGCTTGCAAAAGTGTAGGATCGATGAACAGATATGTTTA
CTGAGGGTGAAAGCACCGTGGCCATTGACAGACAGAGAAGCTATTTTGCAGTTTTTCGTATTTGAATACTTTAAAGACGG
TTTAGTCATCATCCTACTTAACTCGATCGAAGTAGAGAGCAACGGTATAGCTGAAGTAGCGAATGCTGTGAGGATTGACT
TTGTAGGCGGAGTTGCTATACAAAAGGGGACTCCAGAAAGGAGTTACGTAAGATTCATAGCGGAAGTGGATATAAAGCTG
GACTTGGTCCCTCCATCCCTTATCAATTTCATGTCCAGGCAGCTTCTTGGCAACGGTTTCACACTTTTCAAGAAGACTAT
TGGTTCCGTGGCTTATTCAGATGATTACACCAGAGTTTTAGCTGATCCATTGTATACTCAGATACATGAAGCTCTGTATT
CTACTGCTAAAACTAATGAAATCTGCCAGGTAAATGATGTTTTTAGCGAACAAGGAAGGGGCTGTGAAGAGAAAGAACTT
AAGTTGGAAGCTAATGATCTATATATGGCAAAAGAGAATGAGACTCGACATCGCGAGAATGAATCTGTATCTTGCAAAAG
ATATGTTCCTGAGATTGAGGAAGAAGATTGTGTAAATGGAAAAGAAGAATATAAAAGTGTTCCTTCTTCTTCTTCTTCTT
CTTCGGTAGAGGATGAAAATATCACTAGGAAGACTCAAAACAAGAATGGCAAAACACGATTCTGCATAAGTCCAGAAGTG
AAGCAAGCTTTAGGGACACTAGAGAGAGTGATATCAATGGTTAGAAAAACCAAAACTGATAATAATAAGGCATCAACCTC
TTCGGAGGAAGAAGAAGAAGAAGAAACATCATCATCACCATTGCAGAATTCAGGGAGCATTCATCTTGTTTCTAATAGCA
AAGTTTGTATTCAAGATCCTAAAACTGAACTTCTTGATGAAGCATCCTTTGCACATTATAACAACAACAATAACAACAGC
AACAGGCGAAGTGGATCTAGTTCTTTTGCAAGAGAAGGCAACAAAGTAGCTCCTGCATCACCCGAGATCGATCTTACAAC
AAATTCTGAGGTCCCAAGGATAACAGTGTCACAAGCCACAACTCTTTTTAGCCAAACAACAGAGAATTCTGACGACAAAC
CGAGTGGTTTAAATGGAGGTAGCTCAAGTCTGCAGAGGAAAAGTAACCCGGGCTGCTTTGGTTTCAGGTTTTGCATAAGG
ACTTAG