Details for Capsella Locus Carubv10015247m

Position : scaf_3 ( 5`- 3198937 .. 3199594 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015247m

Protein [Map View]
MAAKLNTIVFSIVVLHFLLPAHMHCGPRCGDRCSNTQYKKPCLFFCNKCCAKCLCVPPGTYGNKQVCPCYNNWKTQSGGP
KCP*

DNA
ATGGCAGCAAAACTTAACACCATTGTTTTCTCCATTGTTGTGTTACATTTTCTTCTGCCTGCCCATATGCATTGCGGACC
AAGGTGTGGAGATAGGTGCTCGAATACACAATACAAGAAGCCATGTTTGTTCTTCTGCAACAAATGTTGTGCCAAGTGCT
TGTGTGTACCTCCAGGTACTTATGGTAACAAGCAAGTATGTCCTTGCTACAACAACTGGAAGACTCAGAGCGGTGGACCA
AAATGCCCTTAA