Details for Capsella Locus Carubv10015242m

Position : scaf_3 ( 5`- 8191487 .. 8193458 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015242m

Protein [Map View]
MGSVPDPGELTELAQPSFEEFQKQTSLMTSCTLLWQELSDHFTSLEQNLMKKSEALKQMIESLDNQTQTSLESLNRREVT
IDHSVEIVAGKVGERARAALESLEKARDGGGGDGSNDDSGEVDDEEGLLSALKALCLKMDARGFWNFVTARKKELENLRS
KIPAALGDCVDPAMLVLEAISEVFPVDKRAEKMSNDYGWACVVILESLTPVMVDPVIGKSRLLVTPSVKEKAKEIAETWK
KSLEERGRIENVKTPDVHTFLQHLVTFGIVRSEDLALYRKLVVGSAWRKQMPKLAVSVGLGDQMPDMIEELISRGQQLDA
VHFTFEVGLVDKFPPVPLLKAYLRDAKKAAASMMEDSSNTSRATHLVARKEQSALKAVLKCIEEYKLEEEFPPENLKKRL
DQLEKTKTEKRKPAAVPANKRTRASYNGPMPPAKAGRITNAYVSSFPFIRSPSHSPQYASPAAYPSPPTTVYSNRSPPYP
YSPEIIPNSYQGSPIGYPAYNGYCNGPVPAPAPPVYHPHHHQHHQFHHQQHYY*

DNA
ATGGGGTCAGTCCCCGATCCAGGCGAGTTGACTGAGTTAGCTCAGCCGAGTTTCGAGGAGTTTCAGAAACAGACGTCGTT
GATGACGAGCTGTACTCTACTATGGCAAGAGTTATCCGATCACTTCACTTCTTTGGAGCAGAACCTTATGAAGAAATCCG
AGGCCTTGAAGCAGATGATTGAATCCCTTGATAACCAGACTCAGACCTCGCTCGAGTCACTCAATCGTAGGGAGGTTACG
ATCGACCATAGCGTTGAGATCGTAGCTGGGAAAGTTGGGGAACGAGCTAGAGCTGCTCTTGAGTCGCTGGAGAAAGCTAG
AGATGGTGGCGGTGGTGATGGTTCTAATGATGATTCCGGCGAGGTCGACGATGAAGAAGGGCTTCTCTCTGCTTTGAAAG
CTCTCTGTCTTAAAATGGACGCGAGAGGATTCTGGAACTTTGTGACGGCGAGGAAGAAGGAACTTGAGAATCTCCGGTCA
AAGATTCCGGCGGCGTTGGGGGATTGTGTGGATCCGGCGATGTTAGTGCTTGAGGCGATATCTGAGGTTTTTCCGGTGGA
TAAAAGAGCAGAGAAAATGAGCAATGATTACGGATGGGCTTGTGTGGTGATTCTTGAGAGTTTAACACCTGTAATGGTTG
ATCCAGTGATCGGGAAATCGAGGCTGCTTGTTACTCCCAGCGTTAAGGAGAAGGCTAAGGAGATTGCTGAGACTTGGAAG
AAGAGCTTGGAAGAGAGAGGAAGGATAGAGAATGTGAAGACTCCTGATGTGCATACGTTTCTGCAGCATCTTGTTACATT
TGGAATTGTTAGAAGTGAAGATCTTGCTCTGTATAGAAAGCTTGTTGTTGGATCTGCCTGGCGTAAACAGATGCCTAAGC
TTGCTGTTTCAGTTGGTTTGGGTGATCAAATGCCTGATATGATTGAAGAATTAATCAGCAGGGGACAACAGCTTGATGCT
GTTCATTTTACTTTTGAAGTTGGTCTTGTGGATAAGTTCCCTCCTGTTCCTTTGCTCAAAGCTTATCTAAGGGACGCAAA
GAAGGCAGCAGCTTCTATGATGGAGGACTCCAGCAATACTAGCCGAGCTACGCATCTTGTGGCACGCAAGGAGCAATCAG
CGCTAAAGGCGGTCTTAAAATGCATAGAAGAGTACAAACTCGAGGAAGAGTTTCCTCCAGAGAACCTCAAGAAGCGATTG
GACCAGCTAGAAAAGACCAAAACCGAGAAGAGGAAACCAGCAGCTGTTCCCGCCAACAAGAGAACCCGAGCCAGCTACAA
CGGTCCAATGCCACCAGCCAAAGCCGGGCGTATCACAAACGCATACGTCTCTTCCTTCCCCTTCATCAGATCACCATCTC
ACTCTCCTCAGTACGCCTCACCAGCAGCTTACCCATCCCCACCTACTACAGTCTACAGCAACAGAAGCCCCCCTTACCCA
TACTCCCCTGAGATCATCCCAAACTCATACCAAGGCTCTCCTATTGGTTACCCAGCGTACAACGGTTATTGCAATGGTCC
GGTACCTGCTCCAGCTCCTCCTGTTTATCACCCACACCATCATCAACACCACCAATTCCACCATCAGCAACATTACTACT
GA