Details for Capsella Locus Carubv10015228m

Position : scaf_3 ( 5`- 3560270 .. 3569297 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015228m

Protein [Map View]
MAAANAPIIMKEVLTLPSIGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQPLRRPITADSALMNPNSRIL
ALKAQVPGTTQDHLQIFNIEAKAKLKSHQMPEQVAFWKWITPKMLGLVTQTSVYHWSIEGDAEPVKMFDRTANLANNQII
NYKCSPNEKWLVLIGIAPGSPERPQLVKGNMQLFSVDQQRSQALEAHAASFAQFKVPGNENPSILISFASKSFNAGQITS
KLHVIELGAQPGKPSFTKKQADLFFPPDFADDFPVAMQVSHKFNLIYVITKLGLLFVYDLETASAIYRNRISPDPIFLTS
EASAAGGFYAINRRGQVLLATVNEATIIPFISGQLNNLELAVNLAKRGNLPGAENLVVQRFQELFAQTKYKEAAELAAES
PQGILRTPDTVAKFQSVPVQAGQTPPLLQYFGTLLTRGKLNTYESLELSRLVVNQNKKNLLENWLAEDKLECSEELGDLV
KTVDNDLALKIYIKARATPKVVAAFAERREFDKILIYSKQVGYTPDYMFLLQTILRTDPQGAVNFALMMSQMEGGCPVDY
NTITDLFLQRNLIREATAFLLDVLKPNLPEHAFLQTKVLEINLVTFPNVADAILANGMFSHYDRPRVAQLCEKAGLYIQS
LKHYSELPDIKRVIVNTHAIEPQALVEFFGTLSSEWAMECMKDLLLVNLRGNLQIIVQACKEYCEQLGVDACIKLFEQFK
SYEGLYFFLGSYLSMSEDPEIHFKYIEAAAKTGQIKEVERVTRESNFYDAEKTKNFLMEAKLPDARPLINVCDRFGFVPD
LTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPEDFIKGLILSVRSLLPVEPLVEECEKRNRLRLLTQFLEHLV
SEGSQDVHVHNALGKIIIDSNNNPEHFLTTNPYYDSKVVGKYCEKRDPTLAVVAYRRGQCDEELINVTNKNSLFKLQARY
VVERMDGDLWEKVLTEENEYRRQLIDQVVSTALPESKSPEQVSAAVKAFMTADLPHELIELLEKIVLQNSAFSGNFNLQN
LLILTAIKADPSRVMDYINRLDNFDGPAVGEVAVDAQLYEEAFAIFKKFNLNVQAVNVLLDNVRSIERAVEFAFRVEEDA
VWSQVAKAQLREGLVSDAIESFIRADDATQFLEVIRASEDTNVYDDLVKYLLMVRQKVKEPKVDSELIYAYAKVERLGEI
EEFILMPNVANLQNVGDRLYDEALYEAAKIIYAFISNWAKLAVTLVKLQQFQGAVDAARKANSAKTWKEVCFACVDAEEF
RLAQICGLNIIIQVDDLEEVSEYYQNKGCFNELISLMESGLGLERAHMGIFTELGVLYARYRYEKLMEHIKLFSTRLNIP
KLIRACDEQQHWQELTYLYIQYDEFDNAATTVMNHSPEAWEHMQFKDIVAKVANVELYYKAVHFYLQEHPDIINDLLNVL
ALRLDHTRVVDIMRKAGQLRLIKPYMVAVQSNNVSAVNEALNEIYVEEEDYDRLRESIDLHDSFDQIGLAQKIEKHELVE
MRRVAAYIYKKAGRWKQSIALSKKDNMYKDCMETASQSGDHDLAEQLLVYFIEQGKKECFATCLFVCYDLIRPDVALELA
WMNNMIDFAFPYLLQFMREYSGKVDELIKDKLEAQKEVKAKEQEEKDVMSQQNMYAQLLPLALPAPPMPGMGGGGYGPPP
PMGGMPGMPPMPAYGMPPMGGY*

DNA
ATGGCCGCGGCTAACGCCCCCATCATTATGAAGGAGGTCCTAACGCTTCCGAGCATTGGGATCAACCAACAATTCATCAC
TTTTACAAATGTTACTATGGAGTCTGACAAGTACATATGTGTACGGGAGACGGCACCGCAGAACAGTGTTGTTATTATCG
ATATGAATATGCCGATGCAGCCTTTAAGGAGACCTATAACTGCTGATTCTGCGCTCATGAACCCAAACTCGAGGATCCTT
GCCTTAAAAGCTCAAGTTCCAGGAACTACTCAGGATCATCTACAGATATTTAACATTGAAGCAAAAGCAAAGTTGAAATC
ACATCAGATGCCTGAGCAGGTTGCTTTTTGGAAGTGGATCACACCAAAGATGCTGGGGCTGGTCACACAAACTTCTGTGT
ACCATTGGTCGATTGAAGGTGATGCTGAGCCAGTTAAGATGTTTGATAGAACGGCCAATTTGGCAAACAATCAAATTATA
AACTATAAGTGCTCTCCTAATGAGAAGTGGCTGGTCTTGATTGGAATTGCTCCTGGCTCTCCTGAGAGACCACAATTGGT
AAAAGGAAACATGCAGCTTTTCTCTGTGGATCAACAACGGAGCCAGGCCCTTGAAGCACATGCTGCGTCATTTGCTCAGT
TTAAGGTCCCTGGGAATGAGAATCCTTCTATTCTTATATCTTTTGCAAGCAAGAGTTTTAATGCTGGGCAAATAACATCA
AAGTTACATGTTATTGAACTTGGTGCCCAACCAGGAAAACCATCATTTACAAAAAAGCAGGCAGATCTCTTTTTTCCTCC
AGATTTTGCTGATGATTTTCCTGTGGCCATGCAGGTCTCTCACAAGTTTAACTTGATATATGTCATCACCAAGCTTGGCC
TGCTGTTTGTGTATGATCTAGAGACAGCTTCTGCTATCTACAGAAATCGTATAAGTCCGGACCCAATTTTCTTAACGTCC
GAAGCTTCCGCAGCTGGGGGTTTCTATGCCATTAATAGGCGAGGACAAGTTCTTTTGGCAACAGTAAATGAGGCCACCAT
AATACCTTTTATTAGTGGTCAATTGAACAATTTGGAACTTGCTGTCAATCTTGCTAAGAGAGGAAACCTCCCTGGTGCAG
AAAATCTGGTTGTCCAGAGGTTCCAAGAGTTATTTGCTCAAACAAAGTACAAGGAGGCTGCTGAGCTTGCTGCAGAATCT
CCTCAAGGTATTCTACGGACACCTGACACGGTGGCCAAATTCCAGAGTGTTCCTGTACAAGCAGGGCAAACTCCTCCATT
GTTACAGTATTTTGGGACCCTTTTGACTAGAGGGAAGCTCAATACATATGAGTCCTTGGAACTATCTCGGCTTGTTGTGA
ATCAAAACAAGAAGAACCTCTTGGAAAACTGGTTGGCCGAGGATAAGTTAGAATGCAGTGAAGAACTCGGAGACCTTGTC
AAGACTGTGGATAATGACCTTGCTCTAAAAATATACATCAAAGCTAGGGCAACTCCAAAAGTTGTTGCAGCTTTTGCAGA
GCGAAGGGAGTTTGACAAGATACTGATTTATTCAAAGCAGGTTGGGTACACACCTGATTACATGTTTCTTCTGCAAACGA
TACTCCGTACTGATCCTCAGGGAGCAGTAAACTTTGCTTTAATGATGTCCCAAATGGAAGGAGGTTGTCCAGTTGACTAC
AACACTATCACTGATCTTTTCCTTCAGAGAAATTTGATCCGTGAAGCGACTGCATTCCTTCTGGATGTTCTGAAGCCCAA
TTTACCTGAGCATGCTTTTCTGCAAACTAAGGTTTTGGAGATCAATTTGGTAACCTTTCCTAATGTGGCTGATGCAATAT
TAGCAAATGGGATGTTCAGCCATTATGACCGGCCTCGTGTTGCTCAGCTTTGTGAAAAGGCTGGACTTTACATCCAATCC
TTAAAGCATTACTCAGAGTTACCTGATATCAAACGTGTAATTGTGAACACACATGCTATTGAGCCACAGGCTCTTGTCGA
GTTCTTCGGTACTCTTTCTAGCGAGTGGGCTATGGAGTGCATGAAAGATCTTCTGCTGGTCAACCTGAGAGGCAACCTTC
AGATAATCGTTCAGGCTTGCAAGGAGTACTGTGAGCAACTTGGTGTTGATGCATGCATTAAACTCTTTGAGCAATTCAAG
TCATACGAAGGGCTGTACTTTTTCCTAGGTTCATATTTGAGCATGAGTGAGGATCCTGAGATTCACTTCAAGTACATTGA
AGCAGCTGCCAAGACTGGTCAAATAAAGGAAGTTGAGCGTGTGACTAGAGAGTCTAACTTTTATGATGCTGAAAAGACGA
AGAACTTTTTGATGGAAGCTAAGCTTCCTGATGCCCGACCTTTGATAAATGTCTGTGACCGTTTTGGCTTTGTGCCTGAT
CTTACTCATTACCTCTACACAAACAACATGCTGCGTTATATAGAAGGTTATGTTCAGAAGGTGAATCCTGGGAATGCTCC
CTTAGTTGTGGGGCAGTTGCTTGATGACGAATGCCCTGAAGATTTTATAAAAGGCCTCATTCTTTCAGTTCGTTCATTAC
TTCCTGTTGAACCCCTTGTTGAGGAATGTGAGAAGAGAAATCGACTCCGTCTCCTCACGCAGTTCTTGGAGCATCTAGTT
AGTGAGGGCAGCCAAGATGTGCATGTCCATAATGCCTTGGGTAAAATTATCATAGACAGTAATAACAACCCCGAGCATTT
CCTGACCACCAATCCTTACTACGACTCTAAGGTTGTGGGTAAGTACTGCGAGAAACGTGATCCCACTCTGGCTGTTGTGG
CATACAGAAGAGGACAATGTGATGAGGAACTCATCAATGTCACCAACAAGAACTCTTTGTTCAAGTTACAAGCCAGGTAC
GTAGTGGAGAGGATGGATGGTGACCTCTGGGAGAAGGTTCTTACGGAAGAAAATGAATATAGGAGACAACTTATCGACCA
AGTTGTGTCTACTGCTTTACCAGAAAGCAAGAGCCCAGAGCAAGTTTCTGCAGCTGTTAAAGCATTCATGACTGCTGATC
TGCCGCATGAGCTTATTGAGCTTCTTGAAAAAATTGTGCTTCAAAATTCTGCCTTCAGTGGAAATTTCAATCTGCAAAAT
CTGCTTATATTGACAGCTATTAAGGCAGATCCGTCTAGAGTTATGGATTACATTAACAGGCTAGATAATTTTGATGGTCC
AGCTGTTGGAGAAGTGGCAGTTGATGCACAGTTGTATGAGGAAGCATTTGCGATTTTCAAGAAGTTTAACTTAAATGTTC
AGGCTGTCAATGTACTGTTGGATAACGTCAGAAGCATTGAACGTGCTGTTGAGTTTGCTTTCCGGGTCGAAGAAGATGCT
GTTTGGAGTCAAGTTGCTAAGGCTCAGCTTAGGGAAGGACTGGTCAGTGATGCTATTGAGTCCTTTATCCGAGCTGATGA
TGCCACTCAGTTCCTGGAGGTCATCCGTGCCTCTGAAGATACTAATGTGTATGATGACTTGGTCAAATACCTCCTGATGG
TTAGACAGAAGGTAAAGGAACCCAAGGTGGATAGTGAGCTCATCTATGCTTACGCAAAGGTTGAAAGATTGGGTGAGATT
GAAGAATTTATTCTGATGCCCAACGTTGCTAACCTTCAAAATGTTGGTGACCGCTTGTATGATGAAGCTCTGTATGAGGC
TGCAAAGATAATCTATGCATTCATATCAAATTGGGCCAAGTTAGCTGTCACGCTTGTGAAGTTGCAACAGTTCCAAGGTG
CTGTCGATGCTGCAAGGAAAGCAAATAGTGCAAAGACATGGAAGGAAGTCTGCTTTGCTTGTGTTGATGCTGAGGAATTT
CGACTGGCTCAAATATGTGGACTTAACATTATCATACAGGTGGATGATCTGGAAGAAGTGAGCGAATACTACCAAAACAA
AGGATGCTTCAATGAATTGATCTCACTTATGGAGAGTGGACTTGGTCTGGAACGTGCTCACATGGGTATCTTCACCGAGT
TGGGTGTACTGTACGCCAGATATCGTTATGAGAAGCTTATGGAACACATCAAGTTGTTCTCAACTCGCCTTAATATTCCC
AAGCTTATCCGGGCCTGTGATGAACAACAGCATTGGCAAGAACTTACCTATCTTTACATTCAATATGATGAGTTCGATAA
TGCTGCAACCACTGTCATGAATCATTCTCCTGAAGCATGGGAGCACATGCAATTCAAAGATATCGTTGCCAAGGTTGCGA
ATGTTGAGCTTTACTACAAGGCCGTTCACTTCTACTTACAAGAGCATCCTGACATAATCAACGATCTTCTCAATGTGCTT
GCTTTGCGGTTAGATCACACGCGTGTCGTTGATATTATGCGCAAGGCTGGTCAATTGCGCCTTATCAAGCCATACATGGT
TGCAGTTCAGAGCAACAATGTGTCTGCTGTAAATGAAGCTCTGAATGAGATTTACGTAGAAGAAGAAGACTATGACAGGT
TGCGCGAGTCTATTGATTTGCATGACAGTTTTGACCAGATAGGTCTCGCTCAGAAGATTGAGAAACACGAGCTTGTCGAA
ATGAGACGTGTGGCTGCTTATATCTACAAGAAAGCTGGTAGATGGAAGCAATCGATTGCTTTGTCAAAGAAAGATAACAT
GTACAAGGACTGTATGGAAACTGCTTCACAATCCGGCGACCATGATCTTGCAGAACAACTTCTTGTCTACTTCATTGAAC
AGGGGAAAAAGGAATGCTTTGCTACATGTCTCTTTGTCTGTTATGACTTAATCCGACCAGACGTTGCTCTAGAACTTGCT
TGGATGAACAATATGATTGACTTTGCCTTCCCGTATCTCCTCCAGTTTATGAGAGAATACTCGGGCAAAGTGGATGAGCT
AATCAAGGACAAGCTGGAGGCACAAAAAGAGGTGAAGGCCAAAGAACAGGAAGAGAAGGATGTCATGTCCCAACAGAACA
TGTACGCCCAATTATTGCCACTTGCTTTACCCGCACCACCAATGCCAGGAATGGGAGGTGGTGGGTATGGTCCGCCACCA
CCAATGGGCGGAATGCCAGGAATGCCTCCAATGCCAGCATATGGAATGCCACCGATGGGCGGCTACTAA