Details for Capsella Locus Carubv10015221m

Position : scaf_3 ( 5`- 3414975 .. 3416816 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015221m

Protein [Map View]
MSSSYGKVDEREHVMLEARRKTRKRIATIVVSLVILAVIVIGAVLGTMAHKKSSETVETNSNGDSISVSIKAVCDVTLHK
DKCLETFRSAPNASSLNPEELFKYAVQITMVEVLKALNAFSSSGDLKSNITMDTCAELLDLTIDNLNNTLTSSSNSAVTG
PELVDDLRTWLSSAVTYQETCVETLPPDMKPFGESHLKNSTELSSNALAIITWLGKIADSFKLRRRLLTTADVEVDFHIG
RRLLQSTDLRKVANIVVAKDGSGKYRTISRALQDVPEKSEKRTIIYVKKGVYFENVKVEKKMWNVVVVGDGASKSIVSGR
LNVIDGTPTFKTATFAVFGKGFMARDMGFINTAGPSKHQAVALMVSADHAAIYRCTMNAYQDTLYVHAQRQFYRDCTIIG
TVDFIFGNSASVLQNCRILPRRPMKGQQITITAQGRTDPNMNTGISIHRCNISPLGDLTDVKTFLGRPWKNFSTTVVMDS
FLHGFVDRKGWLPWTGDSAPDTIFYGEYKNTGAGASTRNRVKWKGLRFLSTKEANRFTVKPFLDGGRWLPVTKVPFRSGL
*

DNA
ATGTCCTCCTCCTACGGCAAAGTCGACGAGCGTGAACACGTAATGCTCGAAGCTCGTCGTAAGACGAGAAAGAGAATCGC
AACCATCGTTGTATCACTAGTAATTCTCGCCGTAATCGTGATAGGAGCCGTCTTAGGAACCATGGCTCATAAGAAGTCAT
CAGAGACGGTGGAGACTAACAGCAACGGAGACTCAATCTCCGTTTCCATTAAAGCCGTTTGCGACGTTACGTTGCACAAA
GACAAATGTTTGGAAACCTTTCGATCAGCTCCAAACGCGAGCAGTCTAAATCCAGAAGAGCTCTTCAAATACGCAGTCCA
AATCACAATGGTCGAAGTTTTGAAAGCACTCAACGCATTCTCTTCCTCCGGTGATCTGAAGAGCAACATCACCATGGATA
CATGCGCTGAGCTTCTTGACCTTACGATAGATAACCTAAACAACACGTTAACGTCATCATCAAACAGTGCCGTCACGGGA
CCTGAGCTAGTCGATGACCTCCGTACATGGCTGAGCTCAGCCGTAACGTATCAAGAGACGTGCGTGGAAACGTTGCCTCC
AGATATGAAGCCATTCGGAGAAAGTCATCTCAAGAACTCAACAGAGCTGTCGAGCAACGCATTAGCGATCATCACATGGC
TGGGAAAGATCGCTGACTCTTTCAAACTCCGGAGGCGTCTGTTGACAACCGCTGACGTGGAGGTGGACTTCCACATAGGC
AGGAGATTGTTGCAGAGCACGGATTTGAGGAAAGTGGCAAATATCGTGGTGGCAAAGGATGGTTCGGGGAAGTACAGAAC
GATAAGTAGAGCTTTACAGGATGTGCCTGAGAAGAGTGAGAAGCGGACGATTATATATGTGAAGAAAGGAGTTTATTTTG
AGAATGTGAAGGTGGAGAAGAAGATGTGGAACGTTGTGGTGGTTGGAGATGGAGCGAGCAAGAGTATTGTCTCTGGTAGA
CTTAATGTCATCGATGGAACTCCCACTTTTAAGACCGCAACATTCGCTGTGTTTGGAAAAGGGTTCATGGCAAGAGACAT
GGGCTTCATCAACACAGCCGGTCCATCTAAACATCAAGCCGTAGCACTAATGGTAAGCGCAGATCACGCTGCCATTTACC
GTTGCACAATGAACGCATACCAAGACACGCTCTACGTGCATGCACAACGCCAATTCTACCGTGACTGCACCATCATTGGA
ACAGTCGATTTCATCTTCGGTAACTCAGCTTCAGTTCTCCAGAACTGCCGGATCCTCCCTCGCAGACCAATGAAAGGACA
ACAAATCACAATCACGGCTCAGGGACGTACTGATCCGAACATGAACACAGGAATCTCGATTCACCGTTGTAACATCTCTC
CGCTCGGTGACCTAACCGATGTCAAGACGTTTTTGGGTCGACCATGGAAGAACTTCTCGACCACGGTGGTAATGGATTCG
TTTTTGCACGGCTTTGTTGACCGGAAAGGTTGGTTGCCGTGGACCGGAGATTCAGCGCCTGATACTATATTTTACGGTGA
GTATAAGAACACCGGCGCGGGTGCGTCGACGAGGAATAGGGTTAAGTGGAAGGGGTTGAGGTTTCTTAGTACCAAGGAAG
CTAATAGGTTTACGGTGAAACCTTTCCTCGACGGAGGAAGATGGCTTCCGGTTACGAAGGTGCCGTTCAGGTCCGGTCTC
TGA