Details for Capsella Locus Carubv10015199m

Position : scaf_3 ( 5`- 3856668 .. 3865133 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015199m

Protein [Map View]
MTMMTPPPLDQQEDEEMLVPNPDLVEGPQPMEVAQTEPAVSTVENPPAEDPPSLKFTWTIPIFTRLNTRKHYSDVFVVGG
YKWRILIFPKGNNVDHLSMYLDVADAANLPYGWSRYSQFSLAVVNQLNSRFNIRKETQHQFNARESDWGFTSFMPLSELY
DPSRGYLVNDTVLIEAEVAVRKVLDYWSYDSKKETGFVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDAPTAS
IPLALQSLFYKLQYNDTSVATKELTKSFGWDTYDSFMQHDVQELNRVLCEKLEDKMKGTVVEGTIQKLFEGHHMNYIECI
NVDYKSTRKESFYDLQLDVKGCKDVYASFDKYVEVERLEGDNKYHAEGHDLQDAKKGVLFIDFPPVLQLQLKRFEYDFMR
DTMVKINDRYEFPLQLDLDRENGKYLSPDADKSVRNLYTLHSVLVHSGGVHGGHYYAFIRPTLSEQWYKFDDERVTKEEV
KRALEEQYGGEEELPQNNPGFNNPPFKFTKYSNAYMLVYIRDSDKDKIICNVDEKDIAEHLRVRLKKEQEEKEDKRKYKA
QAHLYTTIKVARDDDITEQIGKNIYFDLVDHEKVRSFRIQKQTPFQQFKEEVAKEFGVPVQLQRFWIWAKRQNHTYRPNR
PLSPNEELQTVGQIREASNKANNAELKLFLEIERGPDDLPIPPPEKSSEDILLFFKLYDPENAVLRYVGRLMVKSSSKPM
DIVGQLNKMAGFAPDEEIELFEEIKFEPCVMCEHLDKKTSFRLCQIEDGDIICYQKPFPIQETECRYPDVPSFLEYVQNR
ELVRFRTLEKPKEDEFILELSKLHTYDDVVERVAEKLGLDDPSKLRLTSHNCYSQQPKPQPIKYRGVDHLSDMLVHYNQT
SDILYYEVLDIPLPELQGLKTLKVAFHSAIKDEVVIHNIRLPKQSTVGDVINELKTKVELSHKDAELRLLEVFFHKIYKI
FPSTERIENINDQYWTLRAEEIPDEEKNIGPNDRLIHVYHFTKEPGQNQQVQNFGEPFFLVIHEGETLEEIKTRIQKKLH
VPDEDFAKWKFASFSMGRPDYLQDSDVVYNRFQRRDVYGAWEQYLGLEHIDNAPKRAYAANQNRHAYEKPVKIYN*

DNA
ATGACTATGATGACTCCGCCGCCGCTTGATCAGCAGGAAGATGAGGAGATGCTTGTTCCGAATCCGGATTTGGTCGAGGG
ACCTCAGCCTATGGAAGTTGCCCAAACTGAGCCTGCTGTTTCCACTGTGGAGAATCCGCCAGCGGAGGATCCTCCAAGTC
TGAAATTCACGTGGACCATCCCAATTTTCACCAGGCTCAATACCAGGAAGCATTACTCTGATGTATTTGTTGTTGGAGGT
TATAAATGGCGTATATTGATTTTTCCCAAAGGAAACAATGTTGACCATTTGTCCATGTACTTGGATGTTGCTGATGCAGC
GAATCTGCCGTACGGGTGGAGCAGATATTCACAATTCAGTCTGGCTGTCGTGAATCAACTCAACAGCAGATTTAACATCA
GAAAGGAGACGCAGCATCAATTCAACGCAAGGGAAAGCGATTGGGGTTTTACATCATTCATGCCTCTCAGCGAGCTCTAT
GATCCAAGTCGAGGATATTTAGTGAATGACACTGTTTTGATTGAAGCTGAAGTTGCTGTGCGTAAAGTTCTTGATTACTG
GTCATATGACTCAAAAAAAGAGACCGGTTTTGTTGGACTTAAAAACCAAGGTGCTACATGTTACATGAATTCTCTCCTGC
AGACGTTATACCACATACCTTACTTCAGAAAGGCTGTGTATCACATGCCAACGACTGAAAATGATGCACCGACTGCCAGT
ATCCCATTGGCGCTCCAGAGTTTGTTTTACAAGCTTCAGTATAATGACACCAGTGTAGCGACAAAGGAGCTGACAAAGTC
ATTTGGTTGGGATACATATGATTCTTTTATGCAACATGATGTCCAAGAACTCAACCGAGTTCTCTGTGAAAAGCTTGAGG
ACAAAATGAAGGGAACTGTTGTGGAGGGAACAATACAAAAGCTATTTGAGGGTCACCACATGAATTACATTGAGTGCATT
AATGTAGACTACAAATCTACTCGAAAAGAATCATTCTATGACCTCCAGCTTGATGTTAAAGGATGCAAAGATGTATACGC
TTCTTTTGACAAGTATGTTGAAGTTGAACGCCTTGAAGGAGACAACAAATACCATGCAGAAGGACATGATTTGCAGGATG
CAAAAAAAGGTGTTCTATTCATAGACTTTCCACCAGTTCTTCAACTTCAGCTCAAGAGGTTTGAATACGATTTTATGCGG
GACACAATGGTGAAGATTAATGATCGGTATGAGTTTCCTCTTCAACTGGATCTCGATAGAGAGAATGGAAAATATTTATC
CCCGGATGCAGACAAGAGTGTTCGCAATCTCTACACCCTCCACAGTGTCTTAGTTCACAGTGGAGGAGTGCATGGAGGGC
ACTATTATGCATTTATTAGGCCAACACTTTCAGAACAGTGGTATAAATTTGATGATGAACGAGTAACAAAGGAGGAAGTG
AAAAGGGCACTAGAAGAACAATATGGTGGTGAAGAAGAGTTACCGCAGAATAATCCTGGTTTCAATAATCCACCTTTCAA
ATTCACAAAATACTCGAATGCGTACATGCTTGTTTATATTCGGGATAGTGACAAGGATAAAATAATCTGCAACGTTGATG
AAAAGGACATTGCCGAACATTTGCGGGTGAGGCTGAAAAAAGAACAAGAAGAAAAGGAAGATAAAAGAAAATACAAGGCT
CAAGCACACCTTTACACGACAATCAAGGTTGCAAGAGATGATGACATCACTGAGCAAATTGGAAAGAATATATATTTTGA
TCTTGTTGACCATGAAAAAGTTCGGAGTTTTCGAATCCAAAAGCAGACCCCCTTTCAACAGTTTAAGGAAGAAGTAGCCA
AAGAATTTGGTGTCCCGGTTCAACTACAGCGGTTCTGGATCTGGGCAAAGCGTCAAAACCATACTTATCGTCCCAATCGT
CCCCTATCACCAAATGAAGAATTACAGACGGTTGGACAAATAAGAGAGGCATCTAACAAGGCAAACAATGCTGAACTTAA
GCTGTTTCTGGAAATAGAGCGAGGACCGGATGACCTTCCTATTCCTCCCCCCGAAAAGTCTTCTGAAGATATTCTTCTTT
TCTTTAAGCTCTATGACCCTGAGAATGCAGTACTAAGATATGTGGGCAGGCTCATGGTGAAAAGTTCCAGTAAGCCTATG
GATATAGTAGGTCAACTGAATAAAATGGCTGGCTTTGCTCCTGATGAGGAAATAGAACTTTTTGAGGAAATTAAGTTTGA
ACCTTGTGTAATGTGCGAACATCTGGATAAGAAGACTTCTTTCAGGCTGTGTCAAATTGAAGATGGAGATATTATTTGCT
ATCAGAAACCTTTTCCTATCCAGGAGACTGAATGTCGATACCCAGATGTGCCATCATTTTTGGAGTATGTACAGAATCGA
GAGCTGGTGCGTTTTCGTACACTGGAAAAACCAAAAGAAGACGAGTTTATTCTGGAGTTGTCAAAGCTGCACACTTATGA
CGACGTCGTGGAAAGAGTAGCTGAGAAGCTTGGCCTTGATGATCCATCGAAACTAAGGCTTACTTCTCACAATTGCTACT
CGCAGCAACCCAAGCCTCAGCCAATCAAATACCGTGGAGTAGATCATCTTTCAGATATGTTAGTTCACTATAATCAGACG
TCTGACATTTTATATTATGAAGTTCTGGACATTCCTCTTCCAGAATTGCAAGGTCTTAAGACCCTAAAAGTTGCTTTCCA
TAGCGCCATAAAGGATGAAGTGGTAATTCACAATATCAGACTACCTAAGCAGAGTACTGTTGGAGATGTTATTAACGAAC
TCAAAACAAAGGTGGAACTTTCACATAAAGATGCAGAACTGAGGTTACTTGAGGTCTTTTTCCACAAGATCTACAAGATC
TTTCCATCTACTGAAAGAATTGAAAACATCAATGATCAGTACTGGACTTTACGAGCAGAGGAGATACCTGATGAAGAGAA
GAACATTGGTCCCAATGATCGGTTAATCCATGTATATCATTTTACTAAAGAACCCGGACAAAATCAGCAAGTACAGAATT
TCGGCGAGCCCTTCTTTTTGGTAATCCATGAAGGTGAAACTTTAGAAGAAATCAAGACCCGTATCCAAAAGAAACTTCAT
GTCCCTGATGAGGACTTTGCTAAGTGGAAGTTTGCATCTTTTTCAATGGGACGACCCGATTACTTGCAGGACTCAGATGT
AGTTTATAATCGCTTTCAGAGAAGAGATGTGTATGGTGCGTGGGAGCAGTATCTTGGGTTGGAGCACATTGATAATGCTC
CTAAAAGGGCTTATGCCGCAAATCAGAACCGACACGCTTATGAGAAGCCGGTGAAAATATACAATTAA