Details for Capsella Locus Carubv10015194m

Position : scaf_3 ( 5`- 6202139 .. 6204698 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015194m

Protein [Map View]
MARCSLVPSINPAHSFRHQFPLPNAPFYFPPSQPIYLRVRKCGFSGGNRHRGVTMAAGTDHYSTLKVNRNATLQEIKSSY
RKLARKYHPDMNKNPGAEDKFKQISAAYEVLSDEEKRSVYDRFGEAGLEGGFNGSQDTSSQGVDPFDLYSAFFGDSDGFF
GGMGESGGMGFDFMNKRSLDLDIRFDLRLSFEEAVFGVKREIEVSYLETCDGCGGTGAKSSSAIKQCSSCDGKGRVMSTQ
RTPFGIMSQVSTCSKCGGEGKIITDKCRKCVGNGRLRSMKKMDVVVPPGVSDRATMRIQGEGNVDKRSGRAGDLFIVLQV
DGKRGIRREGLNLYSNINIDFTDAILGAITKVETVEGTMDLRIPPGTQPGDTVKLYRKGVPDTDRPAIRGDHCFVVKVSI
PKSLSERERKLVEEFSSLRRSTSNTDTRQEEHSFNSDPKKERSWWHKVKNVIRPEDSRAKFGTMSLNPSWPLRRMKAAET
SIILPFLALCVITSAVALVQKKGKRLKQKKEP*

DNA
ATGGCTCGCTGTTCACTGGTTCCGTCTATAAACCCAGCTCATAGCTTCCGTCATCAGTTTCCTCTACCCAATGCGCCATT
CTATTTTCCTCCCTCTCAACCGATTTATTTGCGTGTTCGGAAATGTGGGTTTTCCGGCGGAAATCGCCATCGTGGGGTCA
CCATGGCCGCCGGGACAGACCACTACTCCACTTTGAAAGTCAACCGCAACGCTACCTTGCAGGAGATCAAGAGCTCCTAC
CGAAAACTCGCGCGCAAGTATCACCCGGATATGAACAAGAACCCTGGTGCAGAAGATAAGTTCAAACAGATTAGTGCTGC
TTATGAGGTATTATCTGATGAGGAGAAGAGATCCGTGTATGATCGCTTTGGTGAGGCAGGTTTAGAAGGAGGTTTTAATG
GATCACAGGATACTTCTTCTCAAGGGGTGGATCCATTTGATTTGTACAGTGCATTCTTTGGAGATTCTGATGGATTCTTT
GGGGGAATGGGTGAATCAGGAGGGATGGGTTTTGATTTTATGAATAAGAGAAGCCTAGACCTTGACATTCGGTTTGACCT
GCGGTTGAGCTTTGAAGAGGCAGTATTTGGAGTGAAACGAGAGATTGAGGTTTCTTATTTAGAAACATGTGATGGTTGTG
GAGGAACAGGTGCTAAATCCAGTTCCGCCATTAAACAGTGTAGTAGTTGTGATGGTAAAGGGCGTGTGATGAGCACTCAG
AGAACACCCTTTGGAATCATGTCCCAGGTGTCCACTTGCTCCAAATGTGGCGGTGAAGGCAAAATCATCACTGATAAGTG
TCGAAAGTGCGTAGGCAATGGGAGACTACGGTCTATGAAAAAAATGGATGTTGTTGTCCCTCCTGGTGTCAGCGATAGAG
CCACAATGCGGATTCAAGGAGAAGGTAACGTGGACAAAAGAAGTGGAAGAGCTGGTGACTTGTTCATCGTGCTTCAAGTT
GATGGGAAACGTGGAATTCGCCGGGAAGGGCTTAATTTATACTCCAATATCAACATCGATTTCACAGATGCTATACTTGG
GGCAATCACAAAGGTAGAAACGGTTGAGGGAACAATGGATCTTCGTATTCCCCCAGGAACTCAGCCTGGCGACACCGTGA
AATTATATCGAAAAGGAGTTCCAGACACGGATAGACCTGCAATCCGGGGAGACCATTGCTTTGTAGTGAAGGTTTCGATC
CCCAAAAGCCTGAGCGAGAGGGAGCGCAAATTGGTAGAGGAATTCTCGTCACTCAGAAGATCTACCAGTAATACTGATAC
TCGTCAAGAAGAGCATAGTTTTAACTCAGATCCCAAAAAAGAAAGGTCTTGGTGGCATAAAGTGAAGAATGTCATAAGAC
CGGAGGATTCAAGAGCAAAATTTGGGACTATGAGCTTGAACCCATCATGGCCACTACGAAGAATGAAAGCGGCAGAGACT
TCAATTATTCTCCCGTTCTTGGCTCTGTGCGTTATAACCTCGGCTGTTGCGTTGGTTCAGAAGAAGGGTAAGCGCTTGAA
ACAAAAGAAGGAACCTTAG