Details for Capsella Locus Carubv10015193m

Position : scaf_3 ( 5`- 9266670 .. 9267561 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015193m

Protein [Map View]
DGDKSSSSASLIQVHTPNYTILTESRLSSSSRTSNGTSGMGSRWKGSSRRSNLYWPEKPYTIHEDEVYNEENRGLSVGQC
RAVLVVLGTVVVFSVFCSVLWGASHPFSPIVSVKSFSLHSFYYGEGIDRTGVATKILSFNSSVKVTIHSPAPYFGIHVSS
STFKLTFSTFTLATGQLKSYYQPRKSKHMAIVKLTGAEVPLYGAGPHLAASDKKGKVPVKLEFDIRSQGNLLGKLVKSKH
VNHITCSFFISSSKTSKPIEFSHRTCKHVTK*

DNA
GATGGTGATAAATCCTCATCCTCTGCTTCGCTTATTCAGGTTCATACACCAAACTACACCATTCTCACTGAGTCACGTCT
CTCCTCTTCGAGCCGTACCTCCAATGGGACAAGCGGTATGGGATCTCGGTGGAAAGGAAGCTCCCGGAGGAGTAATTTGT
ATTGGCCGGAGAAGCCTTACACGATTCATGAAGATGAAGTTTATAATGAAGAGAACAGAGGATTGTCAGTGGGACAATGC
AGAGCGGTTTTGGTTGTGTTAGGGACTGTGGTTGTGTTCTCTGTTTTCTGCTCTGTTTTGTGGGGTGCTTCTCATCCTTT
CTCTCCTATTGTATCAGTCAAGAGCTTCAGCCTCCATAGCTTTTATTACGGAGAAGGAATAGACAGAACAGGGGTTGCCA
CCAAGATCCTGAGCTTTAACAGTTCAGTGAAGGTTACAATACACAGTCCTGCTCCTTACTTTGGCATCCATGTCTCTTCT
TCAACCTTCAAACTCACTTTCTCCACTTTCACCCTTGCCACTGGTCAGCTTAAGAGCTATTACCAACCAAGAAAGAGCAA
GCACATGGCCATTGTAAAGCTCACTGGTGCCGAGGTTCCTTTGTATGGAGCAGGACCGCACTTAGCAGCTTCCGATAAGA
AGGGAAAAGTTCCAGTGAAGTTAGAGTTTGACATCAGATCGCAAGGTAACCTTTTGGGGAAGCTGGTCAAGTCGAAGCAC
GTGAATCACATCACATGCTCCTTCTTCATCTCCTCCTCCAAGACATCCAAACCCATAGAATTCAGTCACAGGACCTGTAA
ACACGTTACAAAGTAA