Details for Capsella Locus Carubv10015191m

Position : scaf_3 ( 5`- 4349135 .. 4352222 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015191m

Protein [Map View]
MTSSSGDGGSRVSIPADLLKTIQNIREVTGKQHSDEEIFSVFKECFNDPHETTQKLLYLDTFHEVRSKRERKKENLVSNT
QGRNRTGRRNFASGYTDASNGRNAAFKKQSGANHIIRGSGTVSSAPNNATNDTNPSSKKSPNPIIPSSGISNHKIKEASI
SPVNKGVTKVQPLSKSTSSSEDVVEPDKSKASTVPVAVSDSVVDNDTQYAVDETSQISQQSSMIVSVNCSSQSEQVVKSE
AADKNGKDQSLLTSGVGERPHVTLPIHLQVAKMLENGLTFGSFDSNFVKEASSENCTIGCDDSNIESSQGTTADGAKDLS
TISQDNDHEISNSASETELSLQSDQTVHLVEGLDGDKPLTDTRQTANCDAQPISYPDQYSLAAYQQAMHLFRQQFPLNFF
PYGPYLPPYYMPQPYIHQFVSPNGYQQQSYLPLGDASPPSGVKLPLTHIKSGSNIGNYPSTTFPSPYDSYAFNHFPSVAT
VASTNKEEKKENIYTTGPLSLANLQASPMYNLPLQGQPLPFPTMQAGFTGIYQPSQPILAPSTIPARTEPIGPSHITNQQ
PQAALTNVGNNY*

DNA
ATGACTAGCAGCAGCGGCGATGGCGGCTCTAGGGTTTCGATCCCGGCCGATCTGCTCAAAACCATTCAAAACATCAGAGA
GGTTACCGGAAAACAACATTCCGACGAGGAGATCTTCTCTGTCTTCAAGGAGTGTTTTAATGATCCACATGAAACCACTC
AGAAGCTCCTCTATTTGGATACATTTCATGAGGTGAGAAGCAAACGGGAGAGAAAGAAAGAGAATTTAGTATCAAATACA
CAAGGAAGGAACCGGACTGGACGGAGGAACTTTGCTTCAGGTTATACAGATGCCAGCAATGGAAGAAATGCAGCTTTTAA
AAAGCAGAGTGGAGCTAATCACATAATAAGAGGTTCCGGAACTGTTTCCTCTGCTCCTAACAATGCAACAAACGACACAA
ACCCTTCTTCCAAAAAGTCCCCTAACCCCATAATTCCTTCAAGTGGAATCAGCAACCATAAAATTAAAGAGGCTTCCATC
TCCCCTGTGAACAAGGGAGTCACAAAGGTTCAGCCTCTCTCCAAATCTACTTCTTCTTCTGAGGATGTTGTTGAGCCGGA
TAAGTCTAAAGCAAGTACTGTGCCAGTGGCTGTATCAGATTCTGTTGTAGATAACGACACTCAATATGCTGTAGATGAAA
CTTCTCAGATCTCACAGCAATCTTCTATGATTGTCTCTGTTAATTGCAGCAGCCAATCAGAGCAAGTAGTTAAAAGTGAA
GCTGCAGACAAGAATGGCAAGGATCAATCGCTTCTCACGTCAGGTGTTGGTGAACGGCCGCACGTAACATTACCTATCCA
CCTTCAGGTTGCCAAAATGCTGGAAAATGGACTAACATTTGGGAGTTTCGATTCCAATTTTGTGAAAGAGGCATCATCTG
AGAACTGTACTATTGGGTGTGATGACTCCAATATTGAGTCTTCTCAGGGGACAACAGCCGATGGGGCGAAAGACTTATCA
ACTATTTCTCAAGATAATGATCATGAGATTTCAAATTCAGCATCTGAGACTGAGCTATCATTGCAGTCAGATCAAACTGT
TCACCTTGTAGAAGGTTTGGATGGAGATAAACCACTCACAGACACTCGTCAGACAGCAAATTGTGATGCTCAACCTATCT
CCTATCCTGATCAGTACTCCCTAGCAGCCTATCAACAGGCAATGCACCTTTTTAGGCAACAGTTCCCTCTAAACTTTTTT
CCTTACGGTCCCTATCTTCCACCCTATTATATGCCGCAACCATACATTCACCAGTTTGTGAGCCCAAACGGGTACCAACA
ACAGTCTTACTTACCGCTTGGAGATGCTTCACCACCTTCTGGGGTTAAACTCCCTCTAACTCACATCAAGTCAGGAAGCA
ACATTGGAAACTATCCATCCACCACATTTCCATCCCCATATGATTCATACGCCTTCAACCACTTTCCATCAGTAGCCACT
GTCGCCTCTACCAACAAGGAAGAAAAGAAGGAAAACATTTACACAACTGGACCGCTGAGTCTAGCCAATCTGCAGGCCAG
TCCCATGTACAACTTACCCCTTCAAGGTCAACCATTACCTTTCCCGACCATGCAGGCTGGGTTTACGGGAATATATCAAC
CATCACAGCCCATTCTGGCGCCTTCTACTATACCTGCGAGGACTGAACCGATAGGACCCTCACACATAACTAATCAGCAA
CCTCAAGCTGCGCTAACAAATGTGGGGAACAACTACTAG