Details for Capsella Locus Carubv10015178m

Position : scaf_3 ( 5`- 4227819 .. 4228076 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015178m

Protein [Map View]
MAKNKDDIEYATAQAKLSEDEPIRVSYKHGTPLEGGKIAESEPVELFSSAQRIEQGKDQSVSGGQTQMQRDVKDLRGTRT
DDTPR*

DNA
ATGGCAAAGAACAAGGACGACATAGAGTATGCAACGGCTCAAGCCAAGCTATCGGAAGATGAACCAATCCGTGTAAGCTA
CAAACACGGGACACCATTAGAGGGAGGCAAAATTGCAGAGTCCGAGCCTGTGGAGCTGTTCTCGAGTGCTCAAAGGATCG
AACAGGGAAAAGATCAGTCAGTCTCTGGCGGTCAAACACAGATGCAACGTGACGTTAAAGATCTCCGCGGAACACGTACA
GATGATACTCCTCGTTAA