Details for Capsella Locus Carubv10015173m

Position : scaf_3 ( 5`- 7988752 .. 7989597 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015173m

Protein [Map View]
MVSATSRKITTINSFNKIDYENDFYLSNPNNVSDKELFNKEMSALLVELTDKATDKNNMKNNKFVLYAAGDKRIGTKTVY
AMVQCTKDLVTTSCAACFEWIFKMFSECCDGKRGGRVLGTSCNFRYELYPFLRN*

DNA
ATGGTTTCGGCTACATCGAGAAAGATAACTACCATCAACTCCTTTAACAAGATTGATTATGAGAACGATTTCTATTTGTC
CAACCCGAACAACGTGAGCGATAAGGAGTTGTTCAACAAGGAGATGTCAGCTCTCTTGGTGGAGCTAACAGATAAAGCCA
CCGATAAAAATAACATGAAAAACAATAAGTTTGTGCTTTACGCGGCAGGGGATAAGAGAATTGGAACGAAGACGGTGTAT
GCAATGGTGCAGTGCACGAAAGACTTAGTGACTACATCTTGCGCTGCGTGTTTCGAATGGATTTTCAAGATGTTTTCAGA
GTGCTGTGATGGTAAGCGAGGAGGGAGAGTTTTGGGTACGAGTTGTAACTTTAGGTATGAGTTATACCCTTTTCTTAGAA
ATTAA