Details for Capsella Locus Carubv10015141m

Position : scaf_3 ( 5`- 2796889 .. 2799168 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015141m

Protein [Map View]
MLTHDRDEELSLFLEMRRREKEHRADSCLTGSDNASINGTLKAAAAAALSGVSEMASSQRYPLRRTAAENFLYSENEKSD
YDWLLTPPGTPQFEKEPHRSVMNQLDAPTSRPTVLKSRLGNCREEIVSVNKNKSQTSSSSVAGLRRPSSSGSSRSASRPS
TPTRRSTTPTTSTTRPVTTRASTSRSSTPTSRATLTAARATNSTAAPRTTSTSTSSARSATPTRSNTRPSSAPSKKPVSR
PATPTRRPSTPTGPSIVSSKATSRGTSPSPAVKSSRPWKPPEMPGFSLEAPPNLRTTLSDRPVSASRGRPGVASAPGSRS
GSIERGGGPTSGSVGHARRQSCSPSRGRAPIGNTNGSVTGVRGRAKANNVGSSCDSLSPVAMGNKMVERVVNMRKLGPPR
LTDSGGRGTGKSSSAFNSLGYGRNLSKSSIDMALRHMDIRRGMTGNLRPLVTKVPASSMYSVRSRPASVSSSPVATSSTV
SSSEPSVDNINILCLDGNEAENDDLLSERSYASPRNQFPKFTS*

DNA
ATGTTGACCCACGACAGAGACGAAGAACTCTCTCTGTTTCTTGAGATGCGTCGTCGTGAGAAAGAACACAGAGCTGATTC
TTGTTTAACAGGATCTGATAATGCTAGTATCAATGGAACGTTGAAGGCTGCTGCGGCTGCGGCGCTCTCTGGTGTCTCGG
AAATGGCTTCGTCTCAACGTTATCCTCTCCGGAGAACCGCCGCAGAGAACTTCCTCTATTCGGAGAATGAGAAGTCCGAT
TACGATTGGCTTCTAACTCCGCCAGGCACGCCACAGTTCGAGAAAGAGCCACATAGAAGCGTAATGAATCAGCTTGATGC
TCCCACTTCTCGCCCCACTGTTCTTAAATCTCGGTTAGGGAACTGCCGTGAAGAGATCGTCTCAGTGAACAAGAATAAGT
CCCAAACGAGCTCTTCCTCGGTAGCTGGACTCAGAAGACCATCCTCCTCAGGTAGCTCAAGGTCAGCGAGTAGACCTTCC
ACACCAACGAGAAGGTCTACAACTCCAACCACCTCTACAACAAGGCCAGTGACCACCAGAGCTTCAACCTCTAGATCCTC
AACACCCACCTCACGTGCCACCTTAACTGCTGCACGTGCTACTAACTCAACGGCAGCTCCACGAACCACTAGCACGTCTA
CCAGTTCAGCGAGATCAGCTACTCCAACCCGATCTAATACTCGACCATCTTCTGCACCTTCTAAAAAACCAGTATCAAGG
CCAGCCACGCCAACCCGTAGGCCTTCAACCCCCACTGGTCCATCCATAGTTTCCAGTAAGGCTACGTCCCGAGGGACTTC
TCCTTCTCCTGCTGTGAAGTCTTCCAGGCCATGGAAACCGCCGGAGATGCCTGGTTTCTCTTTAGAAGCCCCACCCAATC
TGAGGACGACTTTATCAGACAGGCCGGTCTCAGCTTCAAGAGGCAGACCTGGAGTAGCCTCAGCACCAGGTTCAAGATCT
GGTTCTATAGAACGCGGAGGTGGTCCCACCAGTGGCAGCGTCGGACATGCAAGAAGGCAATCATGCTCACCGTCCAGAGG
TCGGGCTCCTATTGGCAACACCAATGGAAGTGTCACGGGCGTTCGTGGACGAGCAAAGGCAAACAATGTCGGAAGTAGCT
GCGATAGCTTGAGCCCAGTGGCTATGGGTAATAAAATGGTTGAGAGAGTGGTGAACATGAGGAAACTAGGTCCTCCGCGG
CTAACTGATAGCGGCGGTCGAGGAACCGGGAAATCTAGCTCTGCTTTTAACAGCCTTGGATATGGGAGAAACCTCTCCAA
GAGCTCAATCGATATGGCCTTAAGACATATGGATATAAGACGAGGCATGACGGGAAATCTCCGGCCACTTGTGACGAAAG
TTCCGGCATCATCAATGTACAGTGTGAGAAGTCGGCCGGCTAGTGTCTCAAGCTCTCCGGTAGCCACAAGCAGCACCGTG
AGCTCATCAGAACCGAGTGTTGACAACATCAACATTCTATGCTTAGACGGGAACGAAGCCGAAAACGATGATCTTCTCAG
CGAGAGAAGCTATGCTTCCCCGCGAAACCAGTTCCCCAAATTCACATCTTGA