Details for Capsella Locus Carubv10015139m

Position : scaf_3 ( 5`- 814721 .. 814939 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015139m

Protein [Map View]
MIPICVQCGTGGNPCRCKVVGPTLGLVAFVAAGIVEWPVGALVYIFKHAKGRRIMGHPATHVYPKVSRSIPI*

DNA
ATGATTCCGATATGCGTGCAGTGCGGAACGGGAGGAAACCCTTGCAGATGCAAAGTGGTAGGACCGACGTTAGGGCTTGT
GGCGTTTGTAGCAGCCGGAATAGTGGAATGGCCGGTCGGAGCATTGGTGTATATATTTAAACACGCAAAGGGTCGCCGCA
TTATGGGTCATCCGGCCACCCATGTTTATCCCAAAGTCTCTCGTTCCATTCCCATATGA