Details for Capsella Locus Carubv10015131m

Position : scaf_3 ( 5`- 7941489 .. 7941974 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015131m

Protein [Map View]
MSTKMIVLKSSDNVEFQIEEDVARQCLTIAHWIDDENTNNGVPLTNVKGKILALVTEYCIKHHVDREKPEDLKTWDDKWF
MNLQTDPSTLLALILAANYLDNKTLLDRACQAMADMITEKTVEQIFTDFNIEKGYTDEEEREVLEKINGLLIEKRIIKKK
L*

DNA
ATGTCGACGAAGATGATCGTGTTGAAGAGCTCCGATAATGTAGAGTTTCAGATCGAAGAAGATGTCGCAAGACAATGCCT
GACCATAGCTCATTGGATTGACGACGAGAACACCAACAATGGTGTCCCGCTTACAAACGTGAAAGGCAAGATTCTTGCGT
TGGTGACGGAGTACTGCATCAAGCACCACGTCGATCGTGAGAAACCCGAAGATCTCAAGACGTGGGACGACAAGTGGTTC
ATGAATTTGCAAACCGATCCATCCACCCTCTTGGCACTCATTCTTGCTGCGAATTACCTAGACAACAAAACCCTTCTTGA
CCGAGCCTGCCAAGCTATGGCGGATATGATCACAGAAAAAACTGTGGAACAGATTTTCACAGACTTCAACATTGAGAAGG
GATACACAGATGAGGAAGAAAGAGAGGTTCTTGAGAAAATAAATGGGCTCTTGATTGAGAAGCGGATTATCAAGAAAAAA
CTATAA