Details for Capsella Locus Carubv10015130m

Position : scaf_3 ( 5`- 2450028 .. 2450369 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015130m

Protein [Map View]
MLRTRLLWFTVGFSVSGASIAHLVWRDLYAERFAITSDMKEKFNALEGRVSGLESAGYENPSPAQVSSLSLHL*

DNA
ATGTTGAGAACTCGCCTTCTCTGGTTTACGGTTGGGTTTTCCGTCAGCGGAGCTTCCATTGCTCATCTCGTGTGGCGTGA
TCTCTATGCAGAACGTTTCGCTATAACCTCTGATATGAAGGAGAAATTCAATGCTTTAGAAGGTAGAGTTTCAGGTCTGG
AGTCTGCTGGTTATGAGAATCCGAGTCCAGCTCAGGTCAGCTCTCTCTCTCTCCATTTGTAG