Details for Capsella Locus Carubv10015128m

Position : scaf_3 ( 5`- 13444614 .. 13445885 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015128m

Protein [Map View]
MAATTSSFLIGNQTQIPSLKPRSISQSFIHLTKPNTINLTTRRTKSVSIRCASASTAVGSEQRVFNFAAGPAALPENVLL
KAQSDLYNWRGSGMSVMEMSHRGKEFLSIIQKAESDLRQLLEIPSEYSVLFLQGGATTQFAALPLNLCKSDDSVDYIVTG
SWGDKAFKEAQKYCNPKVIWSGKSEKYTKVPSFDGLEQSPHAKYLHICANETIHGVEFKDYPVVKNPDGILIADMSSNFC
SKPVDVSKFGVIYAGAQKNVGPSGVTIVIIRKDLIGNARDITPVMLDYKIHDENSSLYNTPPCFGIYMCGLVFDDLLEQG
GLKVVEKKNQRKAELLYNAIDESRGFFRCPVEKSVRSLMNVPFTLEKSELEAEFIKEAAKEKMVQLKGHRSVGGMRASIY
NAMPFAGVEKLVAFMKDFQAKHA*

DNA
ATGGCGGCGACGACAAGCTCATTCCTCATCGGAAACCAAACTCAGATCCCTTCCTTGAAACCCAGATCAATTTCTCAATC
TTTCATCCACCTCACCAAACCCAACACCATCAACCTCACCACCAGAAGAACCAAATCCGTTTCAATCCGATGCGCTTCCG
CTTCAACCGCCGTCGGATCCGAGCAACGGGTCTTCAATTTCGCCGCCGGTCCAGCCGCATTACCGGAAAACGTCCTTCTC
AAAGCTCAGTCAGATCTCTATAACTGGCGTGGATCTGGTATGAGTGTCATGGAGATGAGCCACCGTGGTAAAGAGTTTCT
GTCGATCATTCAAAAAGCTGAATCTGATCTCCGTCAGCTTCTCGAGATTCCATCGGAATATTCTGTTTTGTTCTTACAAG
GAGGTGCCACCACTCAATTCGCTGCTTTGCCTCTTAATCTCTGCAAATCTGATGACTCAGTTGATTACATTGTTACGGGA
TCTTGGGGAGATAAAGCTTTCAAGGAAGCTCAGAAGTATTGTAATCCTAAAGTGATTTGGTCTGGTAAATCTGAGAAGTA
CACAAAAGTTCCATCTTTTGATGGATTGGAGCAGAGTCCGCACGCCAAGTATTTGCATATATGCGCCAATGAGACGATTC
ATGGAGTTGAATTTAAAGATTACCCTGTTGTTAAAAACCCTGATGGTATCCTTATTGCTGATATGTCTTCCAATTTCTGT
TCCAAGCCTGTGGATGTATCGAAGTTCGGTGTGATTTACGCGGGTGCACAGAAGAATGTTGGTCCTTCTGGTGTCACCAT
TGTGATCATTCGAAAGGATTTGATCGGTAACGCTAGAGATATCACTCCTGTGATGCTTGATTACAAGATTCATGATGAGA
ACAGCTCGTTGTACAACACGCCTCCGTGTTTCGGGATTTACATGTGTGGTCTTGTGTTTGATGATCTGTTGGAGCAAGGT
GGTTTGAAAGTAGTGGAGAAGAAGAACCAGAGGAAAGCTGAATTGTTGTACAATGCCATTGATGAGAGCAGAGGGTTTTT
CAGGTGTCCTGTTGAGAAGTCTGTGAGGTCTTTGATGAATGTTCCTTTCACGTTGGAGAAATCGGAGTTGGAAGCCGAGT
TTATCAAGGAAGCTGCTAAGGAGAAGATGGTGCAGCTCAAGGGACATAGATCGGTGGGAGGTATGAGAGCTTCCATTTAC
AATGCAATGCCTTTCGCTGGTGTCGAAAAGCTTGTTGCTTTCATGAAAGATTTTCAGGCAAAGCATGCTTGA