Details for Capsella Locus Carubv10015117m

Position : scaf_3 ( 5`- 1546226 .. 1549713 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015117m

Protein [Map View]
MWNGVGNSRGSSKPMRIVVVGEKGTGKSSLILAAARNTFHPNIAPLLPYTNLPSEFFPDRIPATVIDTSSRLEDKGKVVK
EVKQADAIVLTFAFDRPETLDRLSDHWLPLFRQLEVRVPIIVAGCNIDSNGACNQISIEQITSPMMQQYREVETSIQWSA
QRLNQVKNVLYYAQKAVIHPVGPVFNQETNSLKPRCIAALKRIYILSDHDKDCLLNEDELNMLQVKCFDIPLVPSEIKVM
KETMEKKFPPGINEEGLTLDGFLFLNTRFIEEARIQTLWTILRKFGYNNDLRLADDLIPYSLFKRQADQSVELTNIALEF
LWDVYEFFDNDSDNNLKPHEMGYLFETAPESPWKEAPYKDASEETKDGGVSLEAFLSLWSFMTLIDPARTLEYLMYIRFP
HHPSSAIRVTRKRVLDRKEKKSERKVVQCFVFGPKNAGKSALLNQFIGRSYDDDSNNNNGSTDERYAVNIVKESVMINAN
TDKTLVLKEVRIQEDGSMLSNEALAACDVAIFIYDSSDESSWNRAIDLLAEVATIAKDAGYVFPCLMVAAKSDLDSFEMA
IQESTRVTQDIGLDAPIPISSKLGDFGNLFRKILTAAEHPHLNIPEIESKKKKSRKLINKSLMAVSIGTAALIAGMASFH
LYTARKKS*

DNA
ATGTGGAATGGTGTGGGAAATTCTCGTGGCTCGTCGAAACCAATGAGAATTGTTGTGGTTGGTGAGAAGGGCACTGGGAA
ATCAAGCTTGATTCTGGCTGCAGCAAGAAATACTTTCCATCCAAACATCGCTCCTCTGTTACCTTACACCAATTTACCTT
CTGAATTTTTCCCTGACCGTATACCCGCTACTGTCATCGACACTTCTTCAAGACTGGAAGATAAGGGAAAGGTAGTTAAG
GAAGTGAAGCAAGCAGATGCAATTGTTTTGACATTTGCATTCGATAGACCAGAGACTCTTGACCGTTTGAGTGATCACTG
GCTTCCTCTGTTTCGACAGTTAGAGGTGAGAGTTCCTATCATAGTGGCAGGTTGTAATATCGACAGCAATGGGGCTTGTA
ATCAAATCAGCATTGAGCAAATAACGTCACCTATGATGCAACAATATCGAGAGGTCGAGACATCTATCCAGTGGTCTGCT
CAGAGGCTAAATCAGGTTAAAAACGTTCTCTACTATGCACAAAAAGCGGTTATTCACCCAGTAGGGCCTGTGTTTAATCA
AGAAACCAACTCACTGAAGCCGCGCTGTATCGCTGCCTTAAAACGTATCTACATACTGTCTGACCATGACAAGGATTGTC
TTCTCAATGAAGACGAGTTAAACATGCTTCAGGTAAAATGCTTTGATATACCACTGGTGCCTTCTGAAATTAAAGTAATG
AAAGAGACAATGGAAAAGAAGTTTCCACCAGGAATTAACGAAGAAGGGCTCACATTGGATGGTTTCTTGTTTCTAAACAC
ACGGTTTATCGAAGAAGCAAGGATCCAAACACTATGGACTATACTTAGGAAATTTGGGTATAATAACGATCTAAGACTTG
CAGATGACTTGATTCCTTATTCTTTATTCAAACGCCAGGCTGATCAGAGTGTTGAGCTAACAAATATAGCTCTTGAATTC
TTATGGGACGTCTATGAATTTTTTGATAATGACTCTGACAATAACTTGAAACCTCATGAGATGGGATATCTCTTTGAAAC
TGCACCTGAGAGTCCTTGGAAAGAAGCTCCTTATAAAGATGCCTCAGAGGAAACTAAGGATGGAGGAGTCTCTCTTGAAG
CTTTCCTCTCACTGTGGTCATTCATGACACTAATTGATCCAGCTAGGACTCTGGAATATTTGATGTACATTAGATTCCCT
CATCATCCATCTTCGGCGATTCGCGTAACTAGGAAGCGAGTTCTAGACCGCAAGGAGAAGAAATCCGAAAGAAAAGTTGT
ACAGTGTTTTGTGTTTGGCCCCAAGAATGCTGGAAAGTCTGCATTGCTCAATCAATTTATCGGAAGGTCATACGATGATG
ACAGCAACAACAACAATGGATCAACTGATGAACGTTATGCTGTAAATATTGTCAAAGAATCTGTAATGATTAATGCAAAT
ACAGATAAAACTCTGGTGCTGAAGGAAGTTCGAATTCAAGAAGATGGATCTATGTTATCAAATGAAGCATTGGCTGCTTG
TGATGTAGCAATCTTCATCTATGATTCCTCTGATGAGTCCTCGTGGAACAGAGCCATTGATTTGCTTGCTGAGGTTGCAA
CCATTGCCAAAGATGCCGGTTACGTGTTTCCTTGCCTAATGGTTGCAGCAAAATCAGATCTTGATTCATTTGAAATGGCG
ATCCAAGAATCAACTAGAGTTACACAAGATATAGGGCTTGATGCTCCAATACCAATCAGCTCTAAACTGGGAGATTTCGG
TAACTTATTTCGCAAGATCTTAACAGCAGCAGAGCATCCTCATTTGAATATTCCAGAGATTGAGTCAAAGAAGAAAAAGA
GCCGCAAGCTAATCAACAAATCTTTAATGGCAGTTTCAATCGGGACAGCCGCTTTGATCGCTGGTATGGCTTCGTTCCAT
CTCTACACCGCAAGAAAGAAGAGTTAA