Details for Capsella Locus Carubv10015115m

Position : scaf_3 ( 5`- 4116275 .. 4117033 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015115m

Protein [Map View]
MSSSLTLFFFFFFVSTFLYTSSNSFNITNILNEHDDFSTFNNLLSETQLASTINKRQTITVLVVSNGALSSLSGQPTDVI
KKILSLHIVLDYYDQKKLKNLSKKSVLLTTLFQSSGQAKGQQGFLNATVMTNGDVAFGSAVPGSDRNSQLLDSVASLPFN
ISVLHISSAIMIDVKADNAPTASPLSPVSSPPRPAQSPNGDDYDEPPSSAPGAAADGPSSENADSANRVSRIDSLPALAF
TLLMSSIWLFMA*

DNA
ATGTCTTCTTCACTCACTCTCTTCTTCTTCTTCTTCTTTGTTTCCACATTCCTCTACACTTCATCAAATTCATTCAACAT
CACTAACATCTTAAACGAGCACGATGATTTCTCCACTTTCAACAACCTTCTCTCCGAAACTCAACTTGCTTCTACCATCA
ACAAGCGTCAAACCATTACCGTCCTTGTGGTTTCCAACGGCGCACTCTCTTCCCTCTCCGGCCAACCAACCGACGTCATC
AAGAAGATCCTCAGCCTCCACATCGTTTTAGATTACTACGACCAGAAGAAACTCAAGAATCTGAGCAAGAAGTCTGTACT
CCTCACCACTCTTTTCCAATCAAGCGGCCAAGCCAAAGGCCAACAAGGGTTCTTGAACGCTACCGTTATGACAAACGGAG
ACGTGGCGTTTGGATCTGCGGTTCCTGGATCTGATCGTAACTCTCAGCTTCTAGACTCTGTTGCCTCACTACCATTTAAC
ATCTCGGTGCTTCATATTAGTAGTGCTATAATGATTGATGTTAAAGCTGATAACGCACCTACTGCTTCTCCTTTGTCACC
GGTATCATCTCCACCACGCCCTGCACAATCACCTAATGGTGATGATTATGACGAGCCACCATCCTCTGCTCCGGGAGCCG
CTGCTGATGGACCTTCTTCCGAAAACGCTGACTCTGCCAATAGAGTTTCAAGGATCGATTCCCTGCCTGCACTGGCCTTT
ACGCTGTTGATGTCATCCATTTGGCTGTTCATGGCTTGA