Details for Capsella Locus Carubv10015114m

Position : scaf_3 ( 5`- 2891205 .. 2891723 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015114m

Protein [Map View]
MENIKNPKNLDDCTDSISRNSTHQSVADSLNQSRSYICSFCIRGFSNAQALGGHMNIHRRDRAKLRQKLMEDNKDHDDVV
VAESDSSEVVSLDLNEQQQEKALTCDDQDVDRDKSPNQKVGFWVQESKFGTSDNGKVTEVSIDGSSSSHHGEIGGLDLEL
RLGQSVVEKKKT*

DNA
ATGGAAAACATCAAAAACCCTAAGAACCTAGATGATTGTACGGACAGCATATCGAGAAACAGTACTCACCAAAGCGTTGC
TGATTCCCTGAACCAGTCAAGATCATACATATGCAGTTTCTGCATAAGAGGCTTCTCAAATGCTCAAGCACTAGGAGGGC
ATATGAACATCCACAGAAGGGACAGAGCTAAACTGAGACAAAAGCTTATGGAAGATAATAAGGATCATGATGATGTGGTC
GTCGCCGAGAGTGATTCATCAGAAGTTGTCTCTCTAGACCTCAACGAACAACAACAAGAAAAGGCTTTGACATGTGATGA
TCAAGATGTTGACAGAGATAAAAGCCCTAATCAGAAAGTAGGGTTTTGGGTTCAAGAAAGCAAGTTTGGTACTAGTGATA
ACGGAAAGGTCACGGAGGTTAGCATAGATGGTTCGAGTTCGAGTCATCATGGTGAGATTGGAGGCTTGGATCTAGAGCTT
CGGTTAGGCCAAAGTGTTGTGGAGAAGAAGAAAACGTAA