Details for Capsella Locus Carubv10015113m

Position : scaf_3 ( 5`- 654484 .. 656037 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015113m

Protein [Map View]
MASFVAAPTSFSGDSLVKAHRLSSTNFNAIRKSSTLTVKTQSNRSRKLSISAGYRDGSKGGGSSDFVTGFLLGSAVFGTL
AYIFAPQIRRSVLNENEHGFKKPQQPMYYDEGLEERREILNEKIGQLNSAIDNVSSRLRSGGSKNSSSSQSVTVETDAEA
EATA*

DNA
ATGGCGTCCTTCGTAGCAGCTCCCACCTCTTTCTCAGGTGACTCTCTTGTCAAAGCACACCGTTTGTCCTCTACGAACTT
CAATGCGATTCGCAAGAGCTCTACATTGACCGTTAAAACACAATCGAACCGCAGTCGCAAACTCTCGATTTCTGCAGGTT
ACCGTGACGGAAGTAAGGGCGGTGGAAGTAGTGATTTTGTTACGGGGTTTCTTCTAGGAAGTGCTGTGTTTGGTACTCTG
GCTTATATCTTTGCTCCCCAGATCCGGAGATCGGTGCTGAACGAAAATGAACATGGTTTCAAGAAACCACAGCAGCCGAT
GTACTACGATGAAGGCCTAGAGGAGAGAAGAGAGATATTGAATGAGAAAATCGGCCAACTGAATTCAGCCATTGACAATG
TATCGTCGCGCCTAAGGAGCGGTGGCAGCAAGAACAGTTCTTCTTCGCAGTCTGTCACCGTTGAAACCGACGCAGAAGCA
GAAGCTACTGCTTGA