Details for Capsella Locus Carubv10015112m

Position : scaf_3 ( 5`- 805844 .. 807268 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015112m

Protein [Map View]
MEQPTSPGTESVNLRECMESLLCFTLRSHLYEPVPSFDLDLTRDFCLHLLEDDSEKPAVYKLLARALSECLASVGDKNSN
LEKYSKLFHGLGHDLVNMLKKVNFELHVQEPYFTQLKDGLKTVEGRCAVGDYMGISSGAFILFNKCLLLEVQDVHHYTSF
SEMLRVEGLAKVLPGVQVIEEGVRVYRNFYSEEKERLNGVVAIRVAKPANQPYEALAGVLSELKSTGIKSLLDDYTATIT
L*

DNA
ATGGAGCAACCGACATCGCCGGGAACAGAGTCCGTGAACCTCCGTGAATGCATGGAATCACTGCTATGTTTTACCCTCCG
CTCTCACTTATATGAACCCGTTCCAAGTTTCGATCTCGACCTGACCAGAGATTTTTGCCTCCATCTCCTCGAGGATGATT
CAGAGAAACCTGCGGTTTACAAGCTTCTAGCAAGGGCTCTGTCTGAATGTCTAGCTTCCGTGGGTGATAAAAATTCTAAC
TTGGAGAAATACAGCAAACTGTTCCATGGCTTGGGACATGACTTGGTAAATATGTTGAAGAAGGTAAACTTTGAGCTTCA
TGTCCAAGAGCCTTATTTCACACAATTGAAAGATGGTTTGAAAACTGTTGAAGGAAGATGTGCAGTGGGAGACTACATGG
GAATTAGTTCAGGAGCTTTTATCTTGTTCAATAAATGCTTGCTGCTTGAAGTTCAGGACGTTCACCATTATACTTCATTC
TCAGAAATGCTGAGAGTAGAGGGTCTTGCCAAAGTTCTTCCTGGAGTTCAGGTTATAGAAGAAGGTGTTCGAGTTTACAG
AAACTTTTACTCTGAAGAGAAGGAAAGATTGAACGGTGTTGTAGCCATTCGTGTTGCAAAACCAGCTAATCAACCTTATG
AAGCTTTGGCAGGAGTATTATCTGAACTGAAGTCCACTGGGATCAAAAGTCTGTTGGATGACTATACAGCCACAATTACC
TTGTAG