Details for Capsella Locus Carubv10015102m

Position : scaf_3 ( 5`- 6258179 .. 6259781 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015102m

Protein [Map View]
MAEQSKNTPEIFELNNGSMLVKISNYGATITSLSVPDKNGKLADVVLGFDSVDPYVNGLAPYFGCIVGRVANRIKEGKFS
LNGVNYTLPINKPPNSLHGGNKGFDKKIWEVAGHKKDGEKPFITFKYHSADGEEGYPGAVAVTATYTLTSATTMRLDMEA
VPENKDTPINLAQHTYWNLAGHDSGNILDHKIQILGSHITPVDEYTVPTGEILPVKGTPFDFTKEKRIGESIGEVGIGYD
HNYVLDCPDQEKDGLKHAAKLSNGAGSRVLDLWTNVPGLQFYTGNYVNGVVGKGSAVYGKHAGVCLETQGFPNAINQSNF
PSIVAKAGDKYQHTMLFEFSA*

DNA
ATGGCGGAACAGAGCAAGAACACTCCAGAGATCTTCGAGCTCAACAATGGCTCCATGCTGGTCAAGATCTCAAACTACGG
CGCCACCATCACCTCTTTGTCTGTTCCCGACAAGAACGGGAAATTGGCTGATGTAGTTCTCGGATTCGACTCGGTAGATC
CATATGTGAACGGTCTTGCACCGTACTTTGGGTGCATAGTTGGTCGTGTGGCAAATCGAATCAAAGAGGGAAAATTTAGT
CTCAATGGAGTCAACTACACTTTGCCCATCAACAAGCCTCCCAATAGTCTCCACGGTGGTAACAAGGGTTTCGATAAGAA
GATATGGGAAGTTGCAGGGCACAAGAAAGACGGTGAAAAACCTTTCATCACTTTCAAGTATCACAGCGCCGATGGAGAAG
AAGGTTACCCCGGTGCAGTTGCTGTCACGGCAACATACACTCTCACCTCAGCCACGACGATGAGACTTGACATGGAGGCT
GTTCCTGAGAACAAAGACACTCCCATTAACTTAGCTCAGCATACATACTGGAACTTGGCGGGTCATGACTCAGGAAACAT
TCTCGACCATAAGATACAGATTTTGGGGTCTCACATCACCCCCGTTGACGAATACACAGTTCCAACAGGGGAGATCTTGC
CTGTAAAGGGAACTCCTTTCGATTTCACAAAGGAGAAACGGATAGGCGAGTCTATAGGAGAGGTTGGTATCGGATATGAT
CATAACTACGTGTTGGACTGTCCTGATCAAGAGAAGGATGGGCTAAAACACGCAGCGAAGCTCAGTAACGGTGCTGGCTC
AAGGGTATTGGACTTGTGGACCAATGTGCCTGGACTGCAGTTTTATACCGGGAACTATGTGAATGGAGTGGTTGGGAAAG
GGAGCGCCGTTTACGGGAAACATGCGGGTGTGTGCCTTGAGACGCAGGGGTTCCCCAACGCGATTAACCAGTCGAATTTC
CCATCTATTGTGGCTAAAGCTGGTGACAAGTACCAGCACACAATGCTGTTTGAGTTTTCAGCTTGA