Details for Capsella Locus Carubv10015088m

Position : scaf_3 ( 5`- 2995695 .. 2997878 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015088m

Protein [Map View]
MSTESERIDSVSDFSDGSNASRNEVRNAQMSETLADPLTVQAQELIVKPDGDEQEGNGSVASAGGDGMEKINGVTDLEKQ
TKSVNGGLDLGIGTENVGGESNESGKKVLVDSEEVLMVEGDKDSDGIKTVLQVEKEVKPDLVCSHGAGLSDEKVTDVRLD
REDLVEDSKPDGSEKQGTKVDDLDVVCFMGLEPHESKVDDKAPVTAKVKISDSDLVWAKVRSHPWWPGQVFDASAATDKA
QKHFKKGSFLVTYFGDCTFAWNDASRVKPFRQYFSQMAKQSSLPDFIDAIDFALEEVSRRIEFGLACSCISEEVYQKIKT
QNIINPGIRDDSSLIHGADKVSSAIFFEPANLVEYVKRLACSPSYDATDALKFVSQRAQLLAFNRWKGYTDLPQFETLQG
SVESAPKNSAAEGNSSLVKVPDSELKKSKQVYTKRRKTEDQDDGKQDGVFEYEDTTVPKKKEKTLAEFIAEKRLSRCKGN
ISNKNSEKIPHCEKKRKVVNSKLPKSTKKIKANQETEDTGSPISPESDRKNSLSASDKIIPEKARKSFGIGASILKVANQ
MHCSTPTRLLPCSDSTSKKAAKTNGSGKSLQEKPKAKALSERVNSPLTNEKLSNPDAASVTKASSGKSNSICIDHQLSEE
LEQVIKEAPSTNLVKDPELESRDAKDSSKEQMVNKDRKEAADIADEITIEDSNLTGENNSGSDLKEQPSNKSCSDGSDSC
NEDVSAE*

DNA
ATGTCGACGGAATCAGAACGTATTGATTCGGTCTCAGACTTTTCTGATGGCTCTAATGCGTCGAGGAATGAGGTCAGAAA
TGCTCAAATGTCTGAAACCCTAGCTGACCCCTTGACTGTTCAAGCTCAGGAGCTGATAGTAAAGCCTGATGGAGATGAGC
AAGAAGGAAACGGTAGCGTAGCCTCAGCTGGTGGTGATGGGATGGAGAAAATAAATGGAGTTACTGATCTGGAGAAGCAA
ACGAAATCTGTAAATGGAGGATTAGATCTAGGCATTGGAACCGAAAATGTAGGTGGAGAAAGTAACGAAAGTGGGAAGAA
GGTTCTAGTAGATAGTGAAGAGGTATTGATGGTAGAGGGTGACAAAGATTCTGATGGAATCAAAACGGTACTTCAGGTCG
AGAAGGAAGTGAAACCTGACCTGGTCTGTTCTCATGGCGCTGGTCTGAGTGATGAGAAGGTTACTGATGTCAGATTGGAT
AGAGAAGACCTTGTTGAGGATAGTAAACCTGATGGCTCAGAAAAGCAAGGAACAAAAGTTGATGACTTGGATGTTGTATG
TTTTATGGGTTTAGAACCTCATGAGAGCAAGGTTGATGATAAGGCACCTGTAACTGCGAAGGTGAAGATCTCTGACTCTG
ATTTGGTTTGGGCTAAAGTAAGGAGCCATCCATGGTGGCCTGGACAGGTGTTTGATGCTTCGGCTGCAACAGACAAAGCA
CAGAAGCACTTCAAGAAAGGAAGTTTCTTAGTTACATATTTTGGAGATTGCACCTTTGCTTGGAACGATGCATCACGGGT
AAAGCCTTTTCGACAGTATTTCTCCCAAATGGCAAAGCAGAGTAGTCTACCTGATTTTATTGATGCTATTGATTTTGCTT
TAGAAGAGGTATCAAGAAGGATAGAGTTTGGTTTAGCTTGTTCTTGTATCTCAGAGGAAGTCTATCAGAAGATTAAGACG
CAGAACATAATCAATCCTGGAATCCGTGATGATTCAAGCTTAATACATGGTGCAGACAAGGTCTCAAGTGCAATCTTCTT
TGAACCTGCAAACCTTGTGGAATATGTGAAGCGTTTAGCATGCTCTCCTAGCTATGATGCTACTGACGCGCTGAAGTTTG
TAAGTCAGAGAGCACAATTATTAGCTTTTAATCGCTGGAAAGGTTATACAGACCTCCCCCAGTTTGAGACACTTCAGGGG
TCAGTGGAGTCTGCACCCAAGAATTCTGCTGCAGAAGGGAATAGTAGCTTAGTGAAAGTTCCTGATTCTGAATTGAAGAA
GAGTAAACAAGTTTATACTAAAAGGAGAAAGACAGAAGACCAAGATGATGGAAAACAGGACGGAGTGTTTGAATATGAGG
ATACTACCGTTCCAAAGAAAAAGGAGAAAACTTTGGCAGAGTTCATTGCTGAGAAACGCTTAAGCAGATGTAAAGGGAAC
ATATCAAATAAAAATTCTGAGAAAATTCCGCATTGCGAAAAGAAACGCAAGGTTGTGAATTCAAAACTTCCCAAGTCCAC
AAAAAAGATCAAGGCGAACCAGGAAACAGAGGATACAGGATCTCCCATTTCTCCCGAAAGTGATCGAAAAAATAGTTTGT
CTGCTAGTGATAAGATAATACCAGAGAAAGCTAGAAAAAGTTTTGGGATTGGGGCGAGCATATTGAAAGTAGCAAACCAG
ATGCATTGTTCAACACCTACCAGACTCTTACCTTGCAGTGATTCGACCTCCAAAAAGGCAGCCAAAACCAATGGAAGTGG
AAAAAGTCTCCAGGAAAAGCCGAAAGCCAAAGCATTATCTGAAAGAGTTAATTCTCCTTTAACCAATGAAAAGCTTTCAA
ACCCTGATGCTGCTTCTGTTACCAAAGCCTCAAGTGGCAAATCCAATTCCATCTGCATAGACCACCAACTATCCGAAGAA
CTTGAACAGGTCATAAAAGAAGCACCTAGTACTAACCTTGTGAAGGACCCAGAGTTGGAGTCTAGGGACGCGAAAGACTC
TTCTAAAGAGCAGATGGTAAATAAGGATAGGAAAGAAGCTGCAGATATTGCAGATGAAATTACTATAGAGGACAGCAATC
TAACGGGGGAGAATAACAGTGGTTCGGACTTGAAAGAACAGCCTAGTAACAAGAGCTGCTCTGATGGATCTGATAGTTGC
AACGAAGATGTTTCTGCAGAGTAA