Details for Capsella Locus Carubv10015073m

Position : scaf_3 ( 5`- 4673989 .. 4678935 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015073m

Protein [Map View]
MLAFDSKSKIVILGLKEALMRGLIDGDGVFNVSGVDNFIKEVKLEECGLSYAVVSIMGPQSSGKSTLLNNLFGTNFREMD
AFRGRSQTTKGIWIARCAGIEPCTVVMDLEGTDGRERGEDDTAFEKQSALFALAVSDIVLINMWCHDIGREQAANKPLLK
TVFQTPLENLEPVLREDIQKIWDSVPKPQAHKETPLSDFFNVEVVALSSYEEKEEQFKEQVCSQSALHIGEIQCHLILLN
RWFVYNLRQRFFQSVAPGGLAGDRRGVVPANAFAFSAKQMWQVIKDNKDLDLPAHKVMVATVRCEEIANEKFSSFIANEN
WRELEDAVQSGPVSGFGKKLSSILQSCLSEYDTEATYFEESVRSSKRQQLQEKLLQLVQPTFQDVLGHLRSGALENFKHA
FEKALDAGEGFSSSANTCAQSCISKFVKGCEEAVIEQAKWDTSKIQEKLERDIEAHISSVRTAKLSELTTLYESKLNVAL
SGPVEALLDGASDETWPAIRKLLRREGELAVYGLSNALSGFDMDDETRNKMCSDLEKYAQGIVETKAKEEAGRALMRMKD
RFATIFSHDSDSMPRVWTGKEDIRAITKMARSASLKLLSVMAVIRLNDELDNIEKTLTLALFNSTSNNTTSKSISTIDSL
ASSTWEQVAPEKTLITPVQCKSLWRQFKNETEYTVTQAISAQEANRRNNNWLPPPWAILALVVLGFNEFMTLLRNPLWLL
VLFVGYLISKALWVQLNISGEFRNGALPGLLSLSTKFLPTVMNLLKKLAEEGQAPPTNSNQSMNSSAQSEVTTNGESSSS
SSSSGSSPVKTVPIDTSA*

DNA
ATGCTAGCATTTGATTCAAAATCCAAAATTGTGATTCTGGGTTTAAAGGAGGCACTCATGCGAGGACTTATCGATGGAGA
TGGTGTCTTTAATGTTTCTGGTGTTGATAATTTCATCAAGGAGGTTAAGTTGGAAGAATGTGGCCTTTCATATGCTGTTG
TCTCCATTATGGGTCCACAGAGTAGTGGGAAGAGTACGCTCTTGAATAATTTGTTTGGAACAAACTTTAGGGAAATGGAT
GCATTTCGAGGAAGGTCTCAGACGACTAAGGGAATTTGGATTGCTAGATGCGCTGGTATTGAGCCTTGCACTGTTGTGAT
GGATTTAGAGGGTACCGATGGGAGAGAGCGTGGTGAGGATGATACTGCTTTCGAGAAACAGAGTGCTCTATTTGCACTTG
CTGTCTCAGACATAGTTCTTATAAACATGTGGTGTCATGATATTGGTCGGGAACAAGCAGCAAACAAACCTCTTTTAAAG
ACTGTGTTCCAGACGCCACTCGAAAATTTAGAACCAGTCCTGAGGGAAGACATTCAAAAGATATGGGATTCTGTCCCCAA
GCCTCAGGCACACAAAGAAACTCCACTTAGTGATTTCTTCAATGTTGAGGTAGTTGCCCTCTCTAGTTATGAAGAAAAGG
AAGAGCAATTCAAAGAGCAGGTTTGTTCACAATCAGCTTTACATATTGGAGAAATCCAGTGTCACCTTATATTGCTCAAT
AGATGGTTTGTCTATAATTTGAGACAACGGTTTTTCCAATCTGTCGCTCCTGGTGGACTTGCTGGTGATCGACGTGGAGT
TGTCCCTGCCAATGCGTTTGCTTTCAGTGCAAAACAGATGTGGCAAGTCATCAAAGACAACAAAGACTTGGATCTTCCAG
CACATAAGGTCATGGTAGCAACTGTGCGATGTGAGGAAATTGCCAATGAAAAATTCTCTAGTTTTATTGCGAATGAGAAT
TGGCGTGAGTTGGAAGATGCTGTACAGTCTGGTCCTGTTTCTGGATTTGGAAAAAAGCTGAGCTCAATTCTCCAGTCTTG
CTTATCAGAGTATGACACAGAAGCGACATACTTTGAAGAAAGTGTACGATCATCAAAGAGACAACAGCTGCAAGAAAAAT
TATTGCAACTTGTTCAACCAACTTTCCAAGACGTGCTTGGACATTTAAGATCAGGAGCGCTTGAAAACTTTAAGCATGCT
TTTGAGAAGGCCTTGGATGCTGGAGAAGGGTTTTCATCCTCAGCGAATACCTGTGCTCAGTCGTGCATATCTAAGTTTGT
TAAAGGATGTGAAGAGGCTGTTATTGAGCAAGCAAAATGGGATACATCTAAAATTCAGGAAAAGCTTGAGCGAGATATTG
AAGCCCATATATCTTCTGTCCGTACTGCAAAGTTGTCTGAACTGACTACTCTGTATGAGTCAAAACTAAATGTAGCATTA
TCCGGACCGGTGGAAGCACTTCTGGATGGGGCTAGTGATGAAACATGGCCGGCAATAAGAAAGCTACTTAGACGGGAAGG
AGAACTGGCTGTCTATGGTCTATCCAACGCATTATCTGGTTTCGACATGGATGACGAAACACGGAATAAAATGTGCTCTG
ACCTTGAGAAGTATGCACAAGGTATTGTTGAAACCAAGGCAAAGGAAGAGGCTGGAAGAGCGTTGATGCGCATGAAGGAT
AGATTTGCTACAATCTTCAGCCATGATTCTGATTCGATGCCACGTGTTTGGACTGGAAAGGAGGACATCAGAGCTATCAC
AAAAATGGCTCGTTCTGCATCCTTGAAGCTGCTGTCTGTTATGGCTGTTATACGCTTAAATGATGAACTCGACAATATTG
AGAAGACATTGACGCTCGCTCTGTTTAATTCTACGAGCAACAATACTACTAGCAAGAGTATCAGCACAATTGATTCACTC
GCCTCAAGTACTTGGGAGCAGGTTGCACCAGAAAAGACGTTGATCACACCTGTTCAGTGTAAATCTCTGTGGAGGCAATT
CAAGAACGAGACAGAATATACTGTTACACAGGCCATTTCTGCCCAGGAAGCGAACCGGCGGAATAACAACTGGCTGCCAC
CTCCATGGGCAATTCTTGCCCTGGTTGTTCTTGGATTCAATGAATTTATGACTCTCTTAAGAAATCCTCTATGGCTCTTA
GTTCTTTTTGTTGGATACCTTATTTCCAAAGCCTTGTGGGTGCAATTAAATATTTCAGGAGAATTCCGCAATGGCGCGCT
ACCTGGACTTCTCTCCTTGTCAACCAAATTCCTTCCAACGGTCATGAACCTCCTTAAAAAGCTAGCAGAAGAAGGACAAG
CACCACCCACAAATAGCAACCAATCAATGAACTCCTCAGCTCAATCCGAAGTTACAACCAATGGAGAGAGCAGTAGCAGC
AGCAGCAGCTCTGGTTCATCTCCAGTAAAAACCGTACCAATTGATACGAGTGCATAG