Details for Capsella Locus Carubv10015063m

Position : scaf_3 ( 5`- 999167 .. 999515 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015063m

Protein [Map View]
MEKISIKCDFLIFLAVISVMMSSVTIQNVEAKRLLHEAIPETKLHHDEVSTQVITPQIFQCREGCTLKCVPNIFIVECFC
LC*

DNA
ATGGAGAAAATATCAATCAAGTGTGATTTCCTTATCTTTTTAGCTGTTATATCTGTGATGATGAGTAGTGTAACAATTCA
AAACGTTGAGGCAAAACGTTTATTACATGAAGCAATTCCTGAAACAAAGTTGCATCATGATGAAGTTTCAACTCAAGTTA
TTACACCACAAATTTTTCAATGCAGAGAGGGTTGTACCCTGAAATGTGTTCCCAATATATTTATTGTTGAATGCTTTTGT
TTATGCTAA