Details for Capsella Locus Carubv10015059m

Position : scaf_3 ( 5`- 4011907 .. 4013177 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015059m

Protein [Map View]
MFKNTFQSGFLSILYSLGSKPLQIWDKEVVDGHVKRCHDDDIQSNVLEVVGSNIQSTYITCPADLSATLGIKLPFLVLVV
KNVKKYFSFEIQILDDKNVRRRFRASNFQAVTRVKPYICTMPLKMDEGWNQIQLNLADLTRRAYGTNYAETLRVQVHANC
RLRRIYFADRLYSEEELPPEFKLYLPVQKA*

DNA
ATGTTCAAGAACACGTTTCAGTCTGGGTTTCTGTCTATTTTGTACAGTCTAGGGAGCAAGCCTCTTCAGATATGGGATAA
AGAAGTTGTGGATGGTCATGTGAAGCGTTGTCACGATGATGACATTCAATCTAATGTGCTTGAAGTAGTTGGATCTAACA
TCCAGTCTACTTACATTACATGTCCTGCTGATCTTTCCGCTACTCTTGGTATCAAACTTCCTTTTTTGGTCTTGGTTGTG
AAGAATGTGAAGAAATACTTCTCTTTCGAGATTCAAATTCTGGATGACAAGAATGTGCGCCGCCGTTTCAGAGCTTCAAA
TTTTCAAGCTGTTACTAGAGTAAAGCCATATATTTGCACAATGCCATTGAAGATGGATGAGGGATGGAATCAAATCCAGC
TTAACTTAGCTGACCTTACCAGGAGAGCTTATGGGACTAATTACGCTGAGACATTGCGAGTTCAGGTTCATGCTAACTGC
CGCCTTAGGCGCATATATTTTGCTGATCGTCTCTACTCAGAAGAGGAGCTTCCTCCAGAATTTAAGCTATATCTTCCAGT
GCAGAAAGCATGA