Details for Capsella Locus Carubv10015055m

Position : scaf_3 ( 5`- 1785232 .. 1786213 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015055m

Protein [Map View]
MSTATFVEILLAILLPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK*

DNA
ATGAGTACAGCCACCTTCGTCGAGATCCTTCTGGCTATCCTCTTGCCTCCTCTCGGCGTCTTTCTCAAATTTGGTTGCAA
GGTTGAGTTTTGGATTTGTTTGATTTTGACGCTGTTTGGTTATCTTCCCGGGATCCTCTACGCTCTTTACATCATCACCA
AGTAG