Details for Capsella Locus Carubv10015053m

Position : scaf_3 ( 5`- 2154304 .. 2154955 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015053m

Protein [Map View]
MAKSKNHTAHNQSAKAHKNGIKKPMRHRHTSTKGMDPKFLRNQRYARKHNVKGGEIASAEE*

DNA
ATGGCCAAGTCGAAGAATCATACGGCGCATAACCAGTCGGCGAAAGCCCATAAGAACGGAATCAAGAAGCCAATGAGGCA
CCGTCACACCTCAACCAAAGGAATGGACCCCAAGTTCTTGAGGAACCAGAGGTACGCAAGGAAGCACAACGTCAAGGGCG
GCGAGATTGCTAGCGCCGAGGAATAA