Details for Capsella Locus Carubv10015049m

Position : scaf_3 ( 5`- 6483306 .. 6483897 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015049m

Protein [Map View]
MALSSLTWGYARIIAGTLLGGTLGFYVMHRIEVSYKMKMEEALKQYEKEMLRRQEEEKLSLVDEDSG*

DNA
ATGGCGTTGAGCTCACTGACATGGGGTTACGCACGGATCATAGCTGGAACACTTCTCGGGGGGACTCTCGGATTCTACGT
AATGCATCGCATCGAAGTTAGCTACAAGATGAAGATGGAGGAAGCGTTAAAGCAATACGAGAAGGAAATGCTGAGGAGAC
AAGAAGAAGAGAAACTTAGTCTGGTCGATGAAGATTCCGGTTAG