Details for Capsella Locus Carubv10015045m

Position : scaf_3 ( 5`- 5392155 .. 5392591 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015045m

Protein [Map View]
MVCFCFLVDQRRKIKGSKPAAGMCSRCGRGAKVADMKTSTRFCLIPVYCRSRRAIVCTFCGSVLKSYR*

DNA
ATGGTGTGTTTCTGTTTCTTGGTTGACCAGAGGAGGAAGATAAAAGGAAGTAAACCGGCGGCGGGAATGTGTTCCCGGTG
CGGCCGTGGAGCAAAAGTAGCCGACATGAAGACTTCGACGAGGTTCTGTCTGATACCTGTTTATTGTCGATCTCGGAGAG
CCATCGTCTGCACCTTTTGCGGCTCTGTTCTTAAATCCTACCGTTGA