Details for Capsella Locus Carubv10015042m

Position : scaf_3 ( 5`- 526703 .. 527489 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015042m

Protein [Map View]
MDNKQNMSYQAGQATGQTKEKAGGMMDKAKDAAASAQDSLQQTGQQMKEKAQGAADVVKDKTGMNKNN*

DNA
ATGGACAACAAGCAAAACATGAGCTACCAAGCCGGTCAAGCCACCGGTCAGACTAAGGAGAAGGCAGGTGGTATGATGGA
CAAAGCCAAGGATGCTGCTGCTTCTGCTCAAGACTCCTTGCAACAGACTGGACAACAAATGAAGGAGAAGGCACAAGGAG
CTGCTGATGTCGTCAAGGACAAGACCGGCATGAACAAAAACAACTAA