Details for Capsella Locus Carubv10015040m

Position : scaf_3 ( 5`- 5289446 .. 5290906 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015040m

Protein [Map View]
MSNNCGSCDCADKTQCGKKGTSYIVDIVETQESYKEAMIMDVGAEENDANCKCKCGSTCSCTNCTCCPN*

DNA
ATGTCGAACAACTGCGGAAGCTGCGACTGTGCTGACAAGACCCAGTGTGGGAAGAAGGGAACCAGCTACATCGTCGACAT
CGTCGAGACTCAGGAGAGTTACAAGGAGGCCATGATCATGGACGTTGGTGCAGAGGAGAACGACGCAAATTGCAAGTGCA
AGTGCGGATCCACCTGCAGCTGCACCAACTGCACTTGCTGCCCCAACTAA