Details for Capsella Locus Carubv10015028m

Position : scaf_3 ( 5`- 4569087 .. 4570315 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015028m

Protein [Map View]
MGSRGNRVGERWNQMDCDEKSSVIQEEIKRVCKLPSNSVYAVHRLKVLNKINELLSVQRTLSQEKELELLFTQLSL*

DNA
ATGGGAAGCAGAGGTAATCGTGTAGGAGAAAGGTGGAATCAGATGGATTGTGATGAGAAATCGAGCGTGATTCAGGAAGA
GATCAAAAGGGTTTGTAAACTTCCTTCAAACAGTGTTTATGCAGTTCATCGTCTCAAGGTTCTCAACAAAATCAACGAGC
TTTTATCTGTCCAAAGAACGTTGTCTCAAGAGAAGGAGTTAGAGTTGCTCTTCACACAGCTCTCTCTGTAA