Details for Capsella Locus Carubv10015025m

Position : scaf_3 ( 5`- 6123068 .. 6123758 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015025m

Protein [Map View]
MASWKKTIATPFKKAATFFNQPQQSPKKGGRMDAKAREEHEKRMVEELQGEVMACGYDDVLVMWSILDKSNSSNNLTA*

DNA
ATGGCATCATGGAAGAAAACAATAGCAACACCATTCAAGAAAGCGGCAACATTCTTCAACCAACCGCAGCAATCACCAAA
GAAGGGTGGAAGAATGGATGCGAAAGCGAGGGAAGAACACGAGAAGAGAATGGTTGAAGAGCTTCAAGGAGAAGTCATGG
CTTGTGGCTACGACGACGTCCTCGTCATGTGGTCTATTCTTGACAAATCTAACTCCTCCAATAACCTCACTGCTTAA