Details for Capsella Locus Carubv10015024m

Position : scaf_3 ( 5`- 3709170 .. 3710513 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015024m

Protein [Map View]
MSRSGQPPDLKKYMDKKLQIKLNANRMVVGTLRGFDQFMNLVVDNTVEVNGDDKTDIGMVVIRGNSIVTVEALEPVGRS*

DNA
ATGAGTCGATCAGGTCAGCCTCCGGATCTCAAGAAGTACATGGACAAGAAACTCCAAATTAAGCTTAATGCCAACCGAAT
GGTAGTTGGAACTCTCCGTGGGTTTGATCAGTTCATGAATCTTGTTGTGGATAACACTGTTGAAGTGAATGGTGATGACA
AGACTGACATTGGGATGGTGGTGATTAGAGGAAACAGCATTGTCACTGTTGAGGCTCTTGAACCAGTCGGGAGGTCTTAG