Details for Capsella Locus Carubv10015018m

Position : scaf_3 ( 5`- 2919289 .. 2920082 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015018m

Protein [Map View]
MSCCGGNCGCGSGCKCGNGCGGCEMYPDLGFSGETTTTETIVLGVAPAMKNQYEAYGEGNNAENDACKCGSDCKCDPCTC
K*

DNA
ATGTCTTGCTGCGGAGGAAACTGTGGTTGTGGATCTGGCTGCAAGTGCGGCAACGGATGCGGAGGGTGCGAAATGTACCC
AGACTTGGGATTCTCCGGCGAGACGACAACAACTGAGACTATTGTCTTGGGCGTTGCGCCGGCGATGAAGAACCAGTACG
AGGCTTACGGCGAGGGTAACAACGCTGAGAACGATGCTTGCAAGTGCGGATCTGACTGCAAGTGTGACCCTTGCACCTGT
AAATGA