Details for Capsella Locus Carubv10015015m

Position : scaf_3 ( 5`- 3210024 .. 3210510 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015015m

Protein [Map View]
MEKISAFFVILFLVSSCMVTMSVGDICQTDRDCVEIGIPRCKNTGKMPICYNGYCSCYAKRRHRRPPPPPHASSTRNSPS
LS*

DNA
ATGGAGAAAATATCAGCATTCTTTGTCATCCTCTTCCTTGTCTCGTCGTGCATGGTGACAATGAGTGTTGGAGATATATG
TCAAACAGACAGAGACTGTGTGGAGATTGGGATTCCAAGATGCAAGAACACTGGAAAGATGCCTATTTGTTATAATGGAT
ATTGCAGCTGTTACGCTAAAAGGCGTCATCGTCGTCCTCCTCCTCCTCCTCATGCCTCTTCTACTCGAAACTCTCCTTCT
TTATCATGA