Details for Capsella Locus Carubv10015014m

Position : scaf_3 ( 5`- 1719423 .. 1720002 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015014m

Protein [Map View]
MAKILGSICFTTLLLVVLLISSEIPKSEGHCKKFIGEAPFYHPCREKACEASCKEHYPHVACKGECEDHHGEEHCHCYGS
KYH*

DNA
ATGGCAAAGATCTTGGGTTCCATCTGTTTCACCACTCTTTTGCTCGTTGTCTTGCTAATTTCCTCTGAAATCCCGAAGAG
CGAGGGTCACTGTAAGAAGTTTATAGGCGAAGCCCCGTTTTACCACCCATGTAGGGAAAAAGCTTGTGAAGCCTCATGCA
AGGAACATTACCCTCACGTAGCATGTAAAGGAGAGTGTGAGGATCATCACGGCGAAGAGCATTGCCACTGTTACGGTAGT
AAATATCACTGA