Details for Capsella Locus Carubv10015013m

Position : scaf_3 ( 5`- 6916867 .. 6917469 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015013m

Protein [Map View]
MKMKKVLSVYGGVLRLVRLLPADTRPYYAKYARENFVNYREVDQSETSLDELFQRAYNHTLWVLKKYSIDESAAKKLKEI
CFE*

DNA
ATGAAAATGAAGAAGGTGCTGAGTGTATACGGCGGCGTTTTGAGGCTAGTGAGGCTTTTACCGGCGGACACGAGGCCGTA
TTACGCCAAGTACGCCAGGGAGAATTTCGTTAATTACCGTGAAGTCGACCAAAGCGAAACATCCCTCGACGAACTCTTCC
AACGAGCTTACAATCACACACTTTGGGTACTCAAGAAGTATTCCATTGACGAATCCGCCGCGAAGAAGTTGAAAGAGATT
TGTTTTGAATGA