Details for Capsella Locus Carubv10015011m

Position : scaf_3 ( 5`- 8596852 .. 8598346 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015011m

Protein [Map View]
MQASDRFNINSQLEHLQAKYVGTGHADLSRFEWAVNIQRDSYASYIGHYPMLSYFAIAENESIGRERYNFMQKMLLPCGL
PPEREDE*

DNA
ATGCAGGCGAGTGATAGGTTTAACATAAACTCTCAGCTTGAGCATCTTCAAGCTAAGTATGTTGGTACAGGGCATGCGGA
TTTGAGCAGATTTGAATGGGCTGTGAACATTCAGCGTGATAGTTATGCTTCATACATTGGTCACTACCCGATGCTTTCGT
ACTTCGCAATAGCTGAGAACGAATCTATTGGTCGAGAACGCTACAACTTCATGCAGAAAATGCTTTTACCTTGCGGCCTT
CCTCCAGAAAGAGAAGACGAGTAA