Details for Capsella Locus Carubv10015003m

Position : scaf_3 ( 5`- 1644819 .. 1646624 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015003m

Protein [Map View]
METQQKAQAENPPKPAMSSCRKKAKDDANFLEDVKDHIDEFINASMDDHKNCFNKTIKKMFGLSKAVAEKQEAEAKGVES
FLPLQTTISD*

DNA
ATGGAGACGCAGCAGAAAGCTCAAGCTGAAAACCCTCCAAAACCGGCCATGTCTTCTTGTAGAAAGAAGGCAAAGGATGA
TGCCAATTTCCTAGAAGACGTTAAGGATCACATCGACGAATTCATCAATGCGTCAATGGATGATCACAAGAATTGTTTCA
ACAAGACCATCAAGAAGATGTTTGGATTATCAAAGGCTGTTGCAGAGAAGCAGGAAGCTGAGGCTAAAGGAGTCGAGAGT
TTTTTGCCTCTTCAGACAACAATTTCGGATTAG