Details for Capsella Locus Carubv10015001m

Position : scaf_3 ( 5`- 6020320 .. 6021914 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015001m

Protein [Map View]
MPSLQTSLPPELANNVVRLYRECLRRAKFIGKQQHNTELVVGMVRQQFKKHMNETDPEKIQKLKDDAARGLINHMLFESA
KLTGGKVSQRS*

DNA
ATGCCGTCACTGCAAACTTCTCTGCCTCCTGAACTCGCTAACAATGTGGTTAGGTTGTACCGAGAATGTCTTCGTAGAGC
TAAATTTATTGGTAAGCAGCAACACAACACTGAGCTAGTGGTTGGTATGGTGAGGCAACAGTTTAAGAAACATATGAATG
AGACAGATCCTGAGAAGATTCAGAAGCTTAAAGATGATGCTGCTCGGGGACTCATTAATCACATGTTGTTTGAGTCGGCA
AAGCTGACAGGAGGCAAGGTTAGCCAGAGATCCTGA