Details for Capsella Locus Carubv10015000m

Position : scaf_3 ( 5`- 3491863 .. 3495402 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015000m

Protein [Map View]
MTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTMNTASAVTVR
STIRRLREQTES*

DNA
ATGACCAAGAGGACGAAGAAGGCTGGAATTGTCGGCAAATATGGTACACGATATGGTGCCAGTCTTAGGAAGCAGATCAA
GAAGATGGAAGTGAGTCAACACAGCAAGTACTTCTGCGAGTTCTGCGGAAAGTACGCCGTGAAGAGGAAAGCTGTTGGCA
TTTGGGGTTGCAAAGATTGCGGGAAAGTGAAAGCAGGCGGTGCATACACAATGAACACAGCTAGTGCTGTGACAGTTAGG
AGTACCATCAGGCGTTTGAGAGAGCAAACCGAGTCCTAG