Details for Capsella Locus Carubv10014999m

Position : scaf_3 ( 5`- 3182099 .. 3183120 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014999m

Protein [Map View]
VLSVKSIFCAFSLIAAKALPRTQSLSNRMDSQIKHAVVVKVMGRTGSRGQVTQVRVKFTDSDRYIMRNVKGPVREGDILT
LLESEREARRLR*

DNA
GTTCTTTCTGTTAAATCTATCTTCTGCGCTTTCAGTCTTATCGCCGCTAAAGCTCTACCGCGTACGCAGAGCCTCTCTAA
CAGGATGGATTCTCAGATCAAGCACGCTGTTGTAGTGAAAGTGATGGGAAGGACTGGGTCAAGGGGTCAAGTGACTCAGG
TTAGAGTCAAGTTCACTGACTCTGACCGTTACATCATGAGGAACGTCAAAGGACCAGTCAGAGAGGGAGATATTCTCACC
CTTCTTGAGTCCGAGAGAGAAGCCAGAAGACTCCGTTGA