Details for Capsella Locus Carubv10014992m

Position : scaf_3 ( 5`- 5584101 .. 5585229 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014992m

Protein [Map View]
MGKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTGTGRMRYLRNVPRRFKTGFRE
GTEAKPRNKGAASSA*

DNA
ATGGGTAAGGGAACAGGAAGTTTCGGTAAGAGGAGGAACAAGAGTCACACTCTCTGTGTGAGATGTGGTCGTCGTAGTTT
CCACATCCAGAAGAGTCGTTGCTCGGCTTGTGCTTACCCTGCCGCTCGCAAGAGGACTTACAACTGGAGTGTGAAGGCCA
TCAGGAGGAAGACTACTGGTACCGGAAGGATGAGGTATCTCCGTAATGTTCCCCGACGCTTCAAGACTGGATTCAGAGAA
GGTACTGAAGCCAAGCCAAGGAACAAGGGAGCAGCTTCATCAGCATAA