Details for Capsella Locus Carubv10014988m

Position : scaf_3 ( 5`- 1641507 .. 1643032 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014988m

Protein [Map View]
MAESKTKLEEIRKWVSDHKLRTVGCLWLSGITGSIAYNWSQPAMKTSVKIIHARLHAQALTLAALAGAAVVEYYDHKTEA
TNRYPKFLPPENISHKD*

DNA
ATGGCGGAATCAAAGACCAAACTCGAAGAAATCAGAAAATGGGTCTCTGATCACAAGCTCCGTACCGTCGGTTGTTTATG
GCTCAGTGGTATTACCGGTTCTATCGCCTATAACTGGTCTCAACCTGCCATGAAAACCAGTGTCAAGATCATCCACGCCA
GGTTGCACGCTCAGGCGCTGACTTTAGCTGCTTTGGCTGGAGCAGCCGTGGTGGAGTACTATGACCACAAAACTGAAGCT
ACCAACCGCTATCCGAAATTTCTCCCCCCTGAAAACATATCTCACAAAGACTAA