Details for Capsella Locus Carubv10014987m

Position : scaf_3 ( 5`- 3057961 .. 3059203 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014987m

Protein [Map View]
MEKYFGNAYRGDPGVPHADADRFVNIWIGSAAFSVLTWVNPYMWQLSNQFNYHDKWMLFEQYHWKKARAKNQPYEFKWNK
IPKEVRDSYYYNWPVYFP*

DNA
ATGGAGAAGTACTTTGGGAACGCGTACAGGGGTGATCCAGGAGTGCCACATGCTGATGCGGATCGGTTTGTGAATATATG
GATTGGTTCTGCTGCTTTCTCCGTCCTCACCTGGGTTAATCCTTACATGTGGCAGCTCTCCAACCAGTTCAATTATCATG
ACAAGTGGATGCTGTTTGAGCAGTACCACTGGAAAAAAGCAAGGGCAAAGAATCAGCCTTACGAATTCAAGTGGAATAAG
ATACCGAAAGAAGTCAGGGACTCGTATTATTACAACTGGCCTGTCTACTTCCCATAG