Details for Capsella Locus Carubv10014986m

Position : scaf_3 ( 5`- 645599 .. 646364 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014986m

Protein [Map View]
MKMANCIRRNAFFFLTLLFLLSVFNLVQAARGGGKLRPQECNSKCSYRCSATSHKKPCMFFCLKCCKKCLCVPSGTYGNK
QSCPCYNNWKTKEGGPKCP*

DNA
ATGAAAATGGCGAATTGTATAAGAAGAAATGCTTTTTTCTTCTTGACTCTTCTCTTTCTACTCTCAGTCTTCAACCTCGT
TCAGGCTGCTCGTGGTGGTGGCAAACTCCGCCCGCAAGAATGCAACTCGAAGTGTAGCTACCGTTGTTCAGCAACATCGC
ACAAGAAGCCATGCATGTTCTTTTGCCTCAAGTGCTGCAAAAAATGTCTCTGTGTTCCTTCGGGCACCTACGGCAACAAA
CAAAGTTGTCCATGTTACAACAATTGGAAGACTAAAGAAGGCGGTCCTAAATGTCCTTGA