Details for Capsella Locus Carubv10014985m

Position : scaf_3 ( 5`- 8354900 .. 8357088 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014985m

Protein [Map View]
MEAGSSNSSGQLTGRVVDTRGKHRIQAELKRLDQEARFLEEELEQLERMDNVSSSCKEFLDSVDSKPDPLLPETTGPVNE
TWDQWFEKTREAKRCGCTIL*

DNA
ATGGAAGCGGGTAGCTCCAATTCATCGGGTCAGCTTACCGGGCGGGTCGTTGATACAAGAGGCAAACACAGGATTCAAGC
TGAACTCAAAAGGCTTGACCAAGAAGCTCGGTTCTTAGAGGAAGAGCTGGAGCAGCTTGAGAGGATGGATAACGTATCAT
CGTCTTGCAAAGAGTTCTTAGACAGTGTTGATAGCAAACCTGATCCTCTTCTTCCCGAAACAACAGGTCCAGTGAATGAG
ACATGGGATCAATGGTTCGAAAAAACTAGAGAAGCAAAAAGATGTGGCTGCACCATTCTTTGA